April 30, 2008

The Truth Commission update on Maissonueve (press roundup)

150 Years of Abuse, 5 Years of Truth

April 29, 2008

Funded by Ottawa and carried out by churches, the systematic assimilation of natives through residential schooling is a tragic, unsettling piece of Canadian history. As part of an out-of-court settlement that will pay out some $2 billion to survivors of the native school system, the government promised to set up a Truth and Reconciliation Commission to record the tragedy for the history books. On Monday, Indian Affairs Minister Chuck Strahl announced that Justice Harry LaForme will be its chair. LaForme, a member of the Mississaugas of the New Credit First Nation of southern Ontario, is tasked with writing the “official history” of residential schools over the course of the commission’s five-year mandate. “Ultimately, we all want to make sure we achieve a fair and lasting resolution to the sad legacy of residential schools,” he said, as quoted in a CBC News article. The Truth and Reconciliation Commission will serve as a nationwide forum for former aboriginal students, church representatives, and educators to tell their stories. The aim is, in short, to educate Canadians on the impact the residential school system had on some 150,000 aboriginal, Inuit and Métis children who were removed from their communities at age six and forced to attend these schools, where they fell victim to widespread physical and sexual abuse.

LaForme’s $60-million commission will be independent from government, church, and First Nations groups, and will have “unfettered access” to all archives as it explores the 150-year history of residential schools. The task is characterized as monumental, as many former students and school employees are long dead, and many key documents and records have been destroyed. LaForme sees similarities between Canada’s Indian residential schools and South African apartheid, reports the Globe. The commission is, after all, modeled on the commission in South Africa, chaired by Archbishop Desmond Tutu, that explored that country’s policy of segragating black people from white. Strahl indicated that the government plans to make a formal apology to the ninety thousand victims and their families before Parliament breaks for the summer, reports the Post. The commission will be formally established on June 1.

Claire Ward is a Toronto-based MediaScout writer for Maisonneuve Magazine.


Some SPP links via the right wingers ..

Bush Reaffirms North American Union Agenda At Leaders' Summit

Opposition to 'Security and Prosperity Partnership' intensifies


President Bush yesterday reaffirmed a commitment to progress the much maligned Security and Prosperity Partnership agenda, amid intensified opposition from commentators and critics concerned that the plan constitutes an undermining of national sovereignty.
At a private party to open the fourth North American Leaders' Summit in New Orleans, Bush referred to recently encountered "setbacks" and told bureaucrats and business leaders "the meeting gives three friends the chance to come together to discuss our commitment to security and prosperity, to reconfirm the need for the three of us to work in harmony together for the good of our peoples. It's a chance to talk about how we can best protect our people and extend prosperity."
Bush told leaders from Canada and Mexico "Tomorrow, we will be meeting with the business leaders of the North American Competitiveness Council to listen to their specific recommendations... The United States has an opportunity to continue the trading agenda."
The North American Competitiveness Council (NACC) is an advisory Council Comprised of 30 senior private sector representatives of North American corporations that were selected by the American, Canadian and Mexican governments at the June 2006 trilateral meeting in Cancun, Mexico.
Recently uncovered documents detailed how these corporate representatives have been urged to "humanize" North American integration, promote NAFTA success stories to employees and unions and evolve the harmonization agenda "without fueling protectionism".
The documentation consists of internal memos from Canada's Foreign Affairs and Internal Trade ministry, which were obtained by the World Net Daily reporter Jerome Corsi under an Access to Information Act request.

Business leaders have been beseeched by bureaucratic working groups to launch public relations campaigns in order to counter critics of the secretive Security and Prosperity Partnership of North America (SPP) and to report back to senior government officials with advice on an ongoing basis.
The memo highlighted how those advancing the North American integration agenda are concerned about the exposure and subsequent public backlash they have encountered recently.

Meanwhile one prominent critic of the SPP agenda, Congressman Ron Paul has vowed to intensify opposition towards the alliance and the intrinsically linked Trans-Texas Corridor and proposed NAFTA ¡°Super Highway.¡±
¡°As we all know, there have been significant moves recently to expand the Security and Prosperity Partnership initiated by President Bush and his Mexican and Canadian counterparts in 2005. One such plan is to construct a so-called ¡°NAFTA Superhighway running from Mexico, through Texas, and up eventually into Canada, Paul said yesterday.

I have opposed this project from the beginning, signing on as a co-sponsor of House Concurrent Resolution 40 expressing Congressional disapproval of the NAFTA Superhighway and any moves toward a North American Union.¡±


More recently, I introduced an even stronger piece of legislation, H.R.5191, which would prohibit the use of federal funds to carry out this highway project. The federal government has no business being partner to this outrageous plan, according to which countless landowners would have their private property confiscated under eminent domain,¡± Paul said.
This prohibition of funds, if passed, would go a long way toward derailing this ill-conceived project and would send a clear message that further attempts to undermine U.S. sovereignty would not be unchallenged in Congress. It is long past time the United States House and Senate start taking our constitutional oversight roles seriously.¡± The Congressman concluded.
The initial Security and Prosperity Partnership agreement was signed by President Bush, Mexican President Vicente Fox and then-Canadian Prime Minister Paul Martin in Waco, Texas, March 23, 2005. It established working groups, under the North American Free Trade Agreement office.
Jerome Corsi brought attention to the SPP two years ago when he obtained SPP documents, under the freedom of information act, showing that a wide range of US administrative law is being re-written in stealth under a program to "integrate" and "harmonize" with administrative law in Mexico and Canada, just as has become commonplace within the EU.
The documents contained references to upwards of 13 working groups within an entire organized infrastructure that has drawn from officials within most areas of administrative government including U.S. departments of State, Homeland Security, Commerce, Treasury, Agriculture, Transportation, Energy, Health and Human Services, and the office of the U.S. Trade Representative.
Related: Dear Deluded Mass Media, North American Union Agenda Exists

More British Columbia, N. Pacific earthquake information!!

More Earthquakes Out West
Time of Earthquake in other Time Zones Location 48.685°N, 128.888°W Depth 10 km (6.2 miles) set by location program Region VANCOUVER ISLAND, CANADA REGION Distances * 244 km (151 miles) SSW (205°) from Port Hardy, BC, Canada ...
Eastern US Weather - http://www.easternuswx.com/bb/index.php

POTENTIONAL AREAS IN QUAKE RISK ACTION / THE WEST SIDE... USA AND ...
By nightangel7246(nightangel7246)
CHILLIWAC BC LOCATION: THIS AREA NOW IS IN ANOTHER QUAKE RISK DUE TO MORE INTENSE UNDER GROUND ACTIVITY IN PROGRESS. ( UPPER 3.5 MAGNITUDE LEVEL ). WASHINGTON STATE.... THE SHORE LINE REGION AREAS OF: FORKS, PORT ANGELES AND NEAH BAY. ...
THE EARTHQUAKE TRACKER - http://journals.aol.com/nightangel7246/the-earthquake-tracker-/

UPSC (PT) 2008 CURRENT EVENTS
By kendriyevidyalayprimaryteacher
Some forty people are injured when the floor of a Mennonite church collapses during a Christian rock concert in Abbotsford, British Columbia. Two people are killed and more than a dozen injured after a semitrailer crashes into a Chicago ...
UPSC Question Papers - http://upscquestionpapers.wordpress.com

Google Web Alert for: British Columbia earthquake

Earthquake Preparedness - Provincial Emergency Program
Information about earthquake preparedness in British Columbia. ... A guide for BC families and individuals to be prepared for an earthquake. ...

EARTHQUAKE PREPAREDNESS

Everyone talks about "The Big One" and when will it happen (?) – "no one knows for sure". Here are some useful ways to prepare in case an earthquake does occur and impact our immediate area.

CANADA....

THE NORTHERN LOCATION OF: YUKON AREA NORTH AND SOUTH LOCATION. ( 4.0 QUAKE MAGNITUDE LEVEL )

THE ISLANDS LOCATIONS OF: QUEEN CHAROLETTE AT THE SOUTH POINT SEA LOCATION AREA. ( 5.0 QUAKE MAGNITUDE LEVEL )

VANCOUVER ISLAND TO THE AREAS AT NORTH WEST LOCATION OFF SHORE AND TO THE SOUTH EAST AREA OFF SHORE. ( UPPER 4.5 QUAKE MAGNITUDE LEVEL ) WE ALSO HAVE MORE QUAKE RISK NOW THE WHOLE WEST SIDE OF THIS ISLAND REGION. ( PLATE SHIFTING ACTION IN PROGRESS )

CILLLIWACK B.C. LOCATION: THIS AREA NOW IS IN ANOTHER QUAKE RISK DUE TO MORE INTENSE UNDER GROUND ACTIVITY IN PROGRESS. ( UPPER 3.5 MAGNITUDE LEVEL )

WASHINGTON STATE....

THE SHORE LINE REGION AREAS OF: FORKS, PORT ANGELES AND NEAH BAY. ALSO THE STRAIT SAN JUAN DE FUCA AREA AND THE SAN JUAN ISLANDS LOCATION ( UPPER 3.5 QUAKE MAGNTIUDE LEVEL FOR THESE MENTIONED LOCATIONS ).

THE WEST SIDE LOCATION AREAS OF: PAST AND FREQUENT AREAS, WHERE MORE QUAKE MAKING ACTION HAS TAKEN PLACE, TO THE WHOLE EAST SIDE OF THE PUDGET SOUND LOCATION.

PLACES LIKE: DARINGTON, MOUNT BAKER, MOUNT VERNON, ARLINGTON, GRANITE FALLS, SEATTLE, BREMERTON, TACOMA URBAN AREA, LONGVIEW AND MOUNT ST. HELEN... ALL ARE IN QUAKE RISK ACTION.

MOUNT ST. HELEN VOLCANO IS STILL IN INTENSIVE PRESSURE ACTION OCCURRING THE AREA UNDER GROUND. THIS EXTREME LEVEL IS VERY SERIOUS. I STILL FEEL WE ARE GETTING CLOSER TO THAT ERUPTION FROM THIS VOLCANO. CAUTION TO ALL SURROUNDING AREAS.

CAUTION: AGAIN TO ALL PAST FREQUENT QUAKE TARGET LOCATION AREAS. WE HAVE YET MORE INCREASE INTENSITY LEVELS AND MORE PASSING ACTION OF UNDER GROUND MOVEMENT HEADING SOUTH FROM THE UPPER PUDGET SOUND AREA.

THE EAST SIDE... ENTAIT, SPOKANE AREA ( NORTH AND SOUTH ) CHELAN BUTTE AREA, NORTH OF YAKIMA, NORTH OF WALLA WALLA, MOSES LAKE, KENNEWICK AND SUNNYSIDE AREA. ( 3.5 QUAKE MAGNITUDE LEVEL )

THERE IS STRONG ACTION COMING FROM QUAKE PATH 2 AND 3 ROUTES IN MOTION. MORE SIGNS OF WEATHER ACTION INCREASING THE INTENSITY LEVELS SOON AS WELL.

THERE IS ALSO MORE EXTREME PRESSURE COMING FROM THE MOUNT ST. HELEN VOLCANO AREA NOW. THIS ACTION INCREASES THE LEVEL OF QUAKE RISK TO THE SOUTH EAST SIDE FROM THIS VOLCANO AREA.

OREGON STATE....

THE SHORE LINE... AGAIN SHOWING ANOTHER FORCING ACTION OF PLATE SHIFTING IN MOTION. THIS EFFECTS THE WHOLE COASTAL AREA AND SHORE LINE OF OREGON.

IT'S QUAKE PATH 1 ROUTE IN MORE INTENSE FORCE OF ACTION.AND THE WEATHER RAIN ACTION ONLY INCREASES THIS EFFECT OF EARTHQUAKE ACTIVITY.

AT THE COASTAL AREA FROM BANDON ( POORLY CONSTRAINED ) TO NEWPORT AT THE COASTAL AREA IS STILL IN A 5.5 PLUS QUAKE MAGNITUDE LEVEL.

AS FOR THE SHORE LINE IT'S A 3.5 QUAKE MAGNITUDE LEVEL. YACHATS AND WALDPORT AREA OFF SHORE IS STILL IN A QUAKE RISK ACTION DURING THIS TIME PERIOD.

THE WEST SIDE... AREAS OF: PORTLAND, PARKDALE, BEAVERTON, FOREST GROVE, CANBY, WOODBURN, ALBANY, LEBANON, PHOLOMOTH, COLBURG, SPRINGFIELD ( SE ) LOWELL, DRAIN, CAVE JUNCTION, UMPQUA, MEDFORD, GRANTS PASS AND ASHLAND.

THERE IS A STRONG FORCING ACTION COMING IN FROM QUAKE PATH 1 ROUTE. THIS MOTION OF UNDER GROUND MOVEMENT HAS ALREADY EFFECTED THE NORTHERN CALIFORNIA SHORE SIDE LOCATION.

THIS QUAKE PATH ROUTE CAN AND WILL AGAIN MAKE ANOTHER QUAKE TO THE OREGON COASTAL AREA SOON. ALSO DURING THIS EFFORT OF ATTEMPT. WE HAVE THE WEST SIDE HERE TO CONSIDER REGARDING THE EFFECTS THIS ROUTE HAS SET IN IT'S MOTION.

THE EAST SIDE... AREAS OF: FEILDS, THE 3 SISTERS AREA, KLAMATH FALLS, PRINEVILLE AREA, MAUPIN AREA, HUNTINGTON, BAKER CITY, AND THE DALLES. JORDON VALLEY AND BURNS AS WELL.

THERE IS A STRONG PASSING ACTION OF UNDER GROUND MOVEMENT AND INTENSITY INCREASE COMING FROM QUAKE PATH 2 ROUTE IN MOTION NOW. AND WEATHER ACTION OCCURRING NOW WILL INCREASE THE RISK OF QUAKE MAKING ACTION TO THESE LOCATIONS.

ALREADY OCCURRING NOW... TO THE NORTH EASTERN AREAS OF CALIFORNIA HAS BEEN EFFECTED BY THIS QUAKE PATH 2 ROUTE'S ACTION.

BEING RENO NEVADA... IS IN A INTENSE ACTION OF QUAKE OCCURRENCES. THIS EFFECT COULD VERY WELL BE EFFECTING PARTS OF SOUTH EASTERN OREGON. AND COULD VERY WELL BE EFFECTED MY MORE PULSE ACTION OCCURRING UNDER GROUND. SOMETHING TO KEEP IN MIND. IT'S REAL. THAT'S ALSO QUAKE PATH 2 ROUTE'S TRAVEL PATH.





Germany opens huge Nazi crimes archive to public

Wed Apr 30, 2008 1:30pm EDT

BERLIN (Reuters) - Germany opened the world's largest collection of documents on Nazi crimes and their victims to the public on Wednesday.

The International Tracing Service (ITS) in the western town of Bad Arolsen contains about 50 million records on some 17 million victims of Hitler's Nazi regime.

The paperwork, which includes imprisonment orders, death registers and Gestapo notes, reveals details about people who were murdered in the Holocaust, concentration camp survivors and millions of forced laborers and displaced people.

It contains the names of people on "Schindler's List" -- hundreds of Jews saved by businessman Oskar Schindler -- which was the subject of a Steven Spielberg film.

Until Wednesday, the centre allowed only Nazi victims and their relations access.

ITS director Reto Meister said the opening marked the start of a new chapter for the archives more than 60 years after the end of World War Two.

"The opening will contribute to keep alive the memory of the monstrous crimes of the Nazi era," said Meister at the opening ceremony.

The centre is part of the International Committee of the Red Cross and 11 nations are represented on the ITS board -- Belgium, France, Germany, Greece, Israel, Italy, Luxembourg, the Netherlands, Poland, Britain and the United States.

Israel and the United States had long pushed for the archive to open its doors. Germany had been worried about data protection but has received guarantees that information on those still living will remain restricted.

Germany gives the ITS, which is in the process of digitalizing its archives, about 14 million euros ($22 million) a year.

(Reporting by Madeline Chambers; Editing by Robert Woodward)

Related Web News

Hillary Strangelove

Hillary Strangelove...
"We'll meet again, don't know where, don't know when ... " - M. R.


Cheney Takes Aim At... Endangered Whales...
Whales forced to apologize. - M. R.


Here is the plain truth: Sen. Mikulski supports the Military-Industrial Complex, which is a one-trillion-dollar a year drain on our treasury. (2) She doesn't give a good hoot about the troops, who are dying and suffering in Iraq. Her votes for war-funding puts the troops in harm's way, in a conflict which was launched by the Bush-Cheney Gang based on 935 certifiable lies. (3) When the Democrats took control of the Congress in January, 2007, Sen. Mikulski had an opportunity to stop funding this war and to bring the troops home safely. She failed! As a result, 1,055 troops have died since that date and thousands more have been wounded.


Dick Cheney's tenure at Halliburton ended eight years ago, but a federal investigation of alleged bribes from a company subsidiary to Nigerian officials lingers from the Cheney era, raising questions about what the Vice President knew or should have known.


--> Did the US Supreme Court just elect John McCain?
The US Supreme Court has just dealt a serious blow to voters' rights that could help put John McCain in the White House by eliminating tens of thousands of voters who generally vote Democratic.


Clinton is airing this advertisement in Indiana, bemoaning the closure of a defense contractor Magnequench's manufacturing plant in Valparaiso (she is also echoing this line in her stump speeches). Looking at the camera, she tells us she's upset that the 200 jobs that were sent to China, and that "now America's defense relies on Chinese spare parts." And then comes the kicker: She tells viewers that "George Bush could have stopped it, but he didn't."

Clinton is certainly right that it is a tragedy that 200 American jobs were killed in a corporate deal that also exported sensitive military technology to China. But she forgets to mention that it wasn't George Bush who was in the key position to stop it -- it was Bill Clinton.



It saddens me to see how Rev.Wright has taken this whole thing and turned it into a ongoing spectacle and opportunity for his own glory and fame. I am the first to agree with many things that he has said in his sermons and lectures of here lately but I disagree with his timing. Let us get Obama into the whitehouse and then we can look at the truths of this nation and how to repair it.
Meanwhile ...

If guilt by association is your cup of tea, then read on, because I have a couple doozies to share with you!

PHOTOGRAPH OF COCAINE SMUGGLER JORGE CABRERA WITH HILLARY CLINTON.

Jorge Cabrera is a convicted drug dealer and friend of Fidel Castro.

Some News Coverage

MIAMI  --  Jorge Cabrera, a drug smuggler who has emerged as
one of the most notorious supporters of President Clinton's
re-election campaign, was asked for a campaign contribution in
the unlikely locale of a hotel in Havana by a prominent Democratic
fund-raiser, congressional investigators have learned.

[...]

On his return to the United States several days after that
meeting, in November 1995, Cabrera wrote a check for $20,000 to
the Democratic National Committee from an account that included
the proceeds from smuggling cocaine from Colombia to the
United States, said the investigators, who spoke on condition of
anonymity.

[...]

In early January 1996, three weeks after having attended the
Christmas reception at the White House, Cabrera was arrested
and charged with importing 6,000 pounds of cocaine into the
United States on boats through the Florida Keys. Late last year, he
pleaded guilty to those charges and was sentenced to 19 years in
federal prison and fined $1.5 million.

-----
Drug Smuggler Made Clinton Donation in Cuba, Investigators Say
By DON VAN NATTA Jr.
New York Times
April 4, 1997

MIAMI -- Jorge Cabrera, a drug smuggler who has emerged as
one of the most notorious supporters of President Clinton's
re-election campaign, was asked for a campaign contribution in
the unlikely locale of a hotel in Havana by a prominent Democratic
fund-raiser
, congressional investigators have learned.

The investigators said the fund-raiser, whom they identified as
Vivian Mannerud, a Cuban-American businesswoman from Miami,
told Cabrera at a meeting at the Copacabana Hotel in Havana that
in exchange for a contribution he would be invited to a
fund-raising dinner in honor of Vice President Al Gore in an
exclusive enclave near Miami.

Ms. Mannerud owns Airline Brokers Co., an airline charter
service that operates among Havana, the Bahamas and Mexico.

On his return to the United States several days after that
meeting, in November 1995, Cabrera wrote a check for $20,000 to
the Democratic National Committee from an account that included
the proceeds from smuggling cocaine from Colombia to the
United States, said the investigators, who spoke on condition of
anonymity.

Within two weeks of the contribution, Cabrera met Gore at the
dinner in Miami. Ten days later, Cabrera attended a Christmas
reception at the White House hosted by Hillary Rodham Clinton. At
the events, Gore and Mrs. Clinton posed for photographs with
Cabrera, who has two felony convictions dating from the 1980s

and is now in a prison here on a drug-smuggling conviction.

I want to mention this as this is my FUNDRAISING DAY --
David Sirotta, Dan Van Natta, AND MIchael Rivera use this blog as source material.

In the Michale Rivera case (and Chris Floyd, too) - they tell people to STAY AWAY
for this blog. Sure, then they can make money off my work, cherry picking the
work I do.

They never even say thank you. They don't give me a dime. Where do you think
That Sirota got that Carlos Slim picture? Have a guess.

So give me a dime. Do it today, or they don't get to cherry pick me
because there won't be anything left to cherry pick; this blog will be
GONE.

A sorry loss for everyone, in my honest opinion.

Virginia
The coffeecup is right down there.
contribute, please.
I want to stay alive so that my story can be told!!
I need your help!!

See peterfpaul.com
My story is even worse since I don't have a family to bail me out.
These little notifications will be on every blog item I post until I get
enough money to stay afloat.
Don't let SEXISM carry the day anymore.
I am a GREAT investigative journalist, I deserve a break,
I really do.

I'd like to get my shot at writing a book too.
I have a long list of great books I COULD be writing.
And they might ACTUALLY help humanity instead of feeding
Bashers who haven't been out in the streets and on
the TRUTH circuit for forty years like I have.





books of note: Ghandi under Cross Examination

Gandhi: Under Cross-Examination
by G.B. Singh & Tim Watson

Softcover: 166 pages
Publication Date: April 14, 2008
ISBN: 978-0-9814992-0-8
Price: $14 $12.50 through May 5
Size: 6 x 9

Embarking on a historical analysis of Mahatma Gandhi (1869-1948) - the most revered politician/saint of the 20th century - is a daring enough adventure in itself. Any author attempting to remove the halo from this glorified character risks his own reputation in today’s politically correct intellectual world. Books on Gandhi number in the thousands, yet none of them can escape the fact that it is in South Africa where Gandhi nourished his purported ideals following a series of public disgraces encountered at the beginning of his career there.

History books teach that Gandhi’s life changed drastically when, as a young lawyer traveling by train from Durban to Pretoria in pre-South Africa, he faced a series of racial humiliations in 1893. These humiliations galvanized him to fight against apartheid and later against British colonialism. These far-reaching consequences have been attributed to what transpired at the Pietermaritzburg train station where he was evicted from a first class train compartment.

Free informational bookmark included with each book ordered.

In this provocative text, retired U.S. Army Col. G.B. Singh and Dr. Tim Watson subject the 20th century’s most revered figure to a rigorous cross-examination on the witness stand. Who would have dreamed Gandhi would ever be questioned, let alone be cross-examined in court? The court room lessons learned through the historical scrutiny of Gandhi’s racial encounters must spark a re-evaluation of our perceived “historical truths.”

The authors recognize a modern culture of deception and propaganda, and simply wish to set the record straight on this issue. They request that their supporters and detractors alike view the book as a search for honesty in the historical account. This book is sure to provoke lively debates inside and outside the halls of learning. The authors hope all will benefit from the revelations within this book - however shocking - and that the verdict will help free the world from the yoke of “propa-gandhi.”

Col. G. B. Singh (Ret.) served in the U.S. Army. He is a professional student of Indian politics, world religions and their true historical values and political impacts, and the life and teachings of Gandhi. He lives in Tennessee, USA.

Dr. Tim Watson gained his higher education in Europe and taught for several years in East Asia. He currently teaches philosophy and communications in Toronto, Canada, and hosts a weekly radio show at ThatRadio.com.


My appeal for MONEY!!

I live on disability and am really hard up.

I work day after day, night after night to get TRUTH out to anyone who can listen. I have a GLOBALIST point of view, and am no nationalistics (in case you couldn't tell).

I can only do what I do, if you catch my drift. But no one pays me a dime.

In March, I finally put up a coffeecup. That is because BELL took me down. I'll be going to court on that one and my credit at long last will be RUINED, although I kept meticulous records of how BELL SCREWED me.

I have only written for no money so far, although I am to correct that!!

Yesterday, I discovered that although someone DID give me a donation, I didn't even get that. My paypal account was NOT activated!! So .. this month is going to be more than rough, it's probably going to prove to be IMPOSSIBLE for me to stay online. This is a crying shame, because there are some "stories" that only I cover, particularly Canadian ones on indigenous issues -- that get indexed on google. Even Mohawk nation news does not get "indexed" by google - so the only TRUTH about Ardoch Lake comes out on this blog!!

If you come by and read this appeal, drop some money in the coffee cup.

Lots of GUYS get thousands of dollars to do investigative journalism, I do not.

Here is a sample appeal of a good journalist who is asking for $25,000! I like Robert Parry alot. But I also know if I go to him or a few other journalists, they aren't going to help me get grants or even help me get on a proper feed! I write for free for one guy who has a car, a home, a reputation. He doesn't pay me a dime. He still can't even see the forest for the trees. When I post FOR FREE on his online publication, he not ONCE, not ONCE, has responded. He pretends publically that we are the best of friends, we are not. Far from it.

I am not going to get out of this deep dark place by myself. I need a good url, a good blogspace and the knowledge my ISP won't go down.

So today, here I am .. anyone with pennies to spare, send it to ME!!

I will definitely make good use of it, and not waste your nickels.

Here's Robert Parrie's appeal - consider I do a very good job and haven't gotten a red cent from anyone. I don't have a car, I don't have a home, I post really good items 24 hours a day, and I try to show you the PATTERNS and what underlies the actions of all the CORRUPT and EVIL politicians and corporations continually. I have NO MENTOR AT ALL.

So today, if ya have some pennies, put them on my coffee cup. If you still think that sexism doesn't exist, guess again. I don't "hide behind a guy" to keep my life ticking over .. and that means I really get into it trying to stay afloat.

Trust me on that.

Virginia

Robert Parry's appeal letter to me today. (yeah, right)

Our spring fundraiser at Consortiumnews.com has stalled short of its modest $25,000 goal. While that presents problems for our long-term survival, it also has the immediate effect of keeping two important investigative projects on hold.

One project - dealing with the secret history of Republican ties to Iran's Islamist regime - requires an overseas trip that our budget can't cover. The other - relating to corrupt ties between American neoconservatives and Turkish extremists - calls for additional spending on complex research.

We also understand why it sounds odd to many Americans when we ask them to support investigative journalism. Traditionally, that's been the role of big media companies with large budgets.

But the reality of modern America is that these old institutions have failed. During my many years in mainstream Washington journalism, I watched this sorry transformation from the inside.

So, when the country desperately needed an aggressive press corps - as George W. Bush was claiming and consolidating power and then misleading the nation into a catastrophic war - the big media was part of the problem, not part of any solution.

It fell to small, independent outlets like ours to challenge the wrongdoing during Election 2000 and Bush's exploitation of the 9/11 tragedy as a means to stampede the country into the reckless invasion of Iraq.

But we can only survive - and take on the hard stories - with your help.

So, please put us over the top of our fund drive and give us the means to press forward with these important investigative projects.

For those readers who have been able to send us contributions over the past month, thank you.

To make a secure, tax-deductible donation by credit card, click here.

Or you can send a check to: Consortium for Independent Journalism (CIJ); Suite 102-231; 2200 Wilson Blvd.; Arlington, VA 22201.

(For readers using PayPal, address donations to our account, which is named "consortnew@aol.com".)

With donations of $100, we'll send you an autographed gift copy of our latest book, Neck Deep: The Disastrous Presidency of George W. Bush. (Or you can request that we substitute either Robert Parry's Lost History or his book on the rise of the Bush dynasty, Secrecy & Privilege.)

With donations of $150 or more, we'll send the hard cover version of Neck Deep. (We also have a few copies left of Parry's Trick or Treason, which we can substitute, if you wish, while supplies last.)

As always, thank you for your support!

Robert Parry, Editor

Robert Parry broke many of the Iran-Contra stories in the 1980s for the Associated Press and Newsweek. His latest book, Neck Deep: The Disastrous Presidency of George W. Bush, was written with two of his sons, Sam and Nat, and can be ordered at neckdeepbook.com. His two previous books, Secrecy & Privilege: The Rise of the Bush Dynasty from Watergate to Iraq and Lost History: Contras, Cocaine, the Press & 'Project Truth' are also available there. Or go to Amazon.com.


"WATCH THE COPS" - CANADIAN battle cry!! - MNN news

”WATCH THE COPS” DAY ON MAY 29 AND EVERY DAY MNN.

April 28, 2008. Canada and Phil Fontaine of the “Assembly of Colonial First Nations” would like to see us standing by the side of the road with our heads down, tears rolling down our cheeks and handing out pamphlets on their “Aboriginal Day of Action” on May 29th. [Beware! It’s an Indigenous “set up” day!] Many think this should be “watch the goons day”. We could walk, drive or bicycle through the roads, streets and highways of our communities and document police brutality and oppression. We’ll be needing a great big notebook for this.

Non-Indigenous communities have their problems with cops too. Maybe they’ll join us. Recently a young student was given a $628 ticket for “sitting on a wall in a park” and for snapping pictures of them on his cell phone. They were harassing homeless people.

We should be monitoring these colonial henchmen. It’s come to the point now where it’s not really safe to go out alone anymore. The abuse has got to stop. Take cameras, cell phones, become a witness and make good notes. We need names, badge numbers and photos of the abuse and the abusers. Then we should file complaints, take them to court and put pressure on politicians who cave into police pressure.

We need “know-your-rights” classes. “Watch the goons” should make periodical reports and publish them regularly on the internet. We want to reduce Police Violence Through Accountability; and to Empower and Unite our communities by looking out for each other. [From: berkeley-copwatch@lists.riseup.net]

In Montreal when the Montreal Canadians hockey team won their series against the Boston Bruins, there was a riot on St. Catherine Street. The media coverage showed cop cars being burnt and kids jumping up and down on top of the cars. Many young people were assaulted and arrested. The police confiscated mainstream media footage so no one could see that they had gotten out of their cars, went over to a crowd of young people and started smashing them for no reason at all. People with phone cameras put these images on the internet. It was an emotional response to abuse. The cops have become the worse abusers.

Watch out for agent provocateurs. They arrive dressed like us, with back packs on their back full of rocks and other implements. They start throwing these at the police and then disappear into the crowd. We get the blame. Let’s face it, cops are attracted to violence. They can’t stand peaceful people. So they try to stir things up so they can use all the expensive toys they claim to need. One of their most despicable tactics is to target and attack young women. This provokes otherwise peaceful men to come to their defense who are then beaten and arrested. What a violent profession. We do not approve of the theory that peace can be gained by violent means.

The cops assume that those who protest their abuse must be under the spell of some kind of “leader”. They don’t want their misdeeds to be made public. There is nothing original about what the cops are doing. They phone the acquaintances of their target and try to get information or get them on side, even offer money and safety. Safety from what! Them? What’s the difference between police action and extortion? In other words, don’t have a leader for them to target!

The cops want more control in Southeastern Ontario because it’s getting harder to illegally siphon the resources of enlightened Indigenous people. The highly trained people like doctors, miners, scientists, politicians, military and corporation heads need relative order to go about their job of stealing our water and energy.

The factory jobs are now outsourced. This area is being built up for the elites. We Indigenous people are in their way. This puts us at risk. They still have depopulation plans for us in areas where they don’t want us. Haudenosaunee Territory includes prime land and a vast watershed.

For example, condos were going to be built on the beautiful Bay of Quinte until we stopped it. The elite always want to be on the water. We Mohawks spoil their view. These condos might have been for the workers at the new proposed U.S. Joint Task Force 2 Training Base that is being set up at Trenton Ontario, just a 20-minute drive from Tyendinaga.

Sharbot Lake-Robertsville Mine site is half way between Trenton and Petawawa Army Bases. Sharbot Lake is also half way between Port Hope and Chalk River, which have the most depleted uranium stored for use by the military to make bombs.

Trenton Army Base is right near Port Hope to guard that nuclear waste. Petawawa soldiers would be available to clean up nuclear messes at Chalk River, as happened in 1958 when one of the research reactors took a leak.

The colonists don’t want all-out warfare here. In guerrilla warfare our great strength is when we are on our home turf. We know it and we feel the power that comes from being truly Indigenous. This is not understood by the colonists. They come from fragmented and abused backgrounds. They don’t know what a real community is. In their ignorance they’ve fallen under the delusion that they have to use “low level” warfare by attacking, harassing, taking prisoners, breaking our arms, surrounding us from time to time and putting out bad stories about us to scare the public. The alternative, peaceful co-existence, is simply unthinkable to them.

Their psychological warfare strategies are meant to destroy all hope amongst our people and sow seeds of terror in our communities. They want to create fear and submission.

The cops wear armor and cover their faces with hideous visors and shave their heads like fascists. They are loaded with so much equipment they can hardly hear, see or move. These cops are scared and not sure why they’re in our communities pointing guns at unarmed people but they’re getting big pay. There are women and children on the roads too. The cops stand there shivering afraid of what will happen to them if they don’t follow the crazy orders they are being given.

The Mohawks took some of the stuffing out of the OPP cops who have been trying out some of their low level warfare tactics on us which aren’t working. If we have courage and know we are right in what we are doing, then we will stand up to them. This perplexes them. They thought it was going to be over a long time ago. Obviously they haven’t read their history. We’re still here after 400 years. And we ain’t going nowhere.

Our persistence and perseverance comes from our ancestors. We are so well rooted with nourishment from the land. A “transplant’s” root has to adjust for a long time to gain strength from the earth, but their roots really don’t take. Most of them tumble about like rolling stones, shifting with every twist and turn of the bankrupt and exploitive economy they brought here.

Such transplants need a lot of crutches – like guns, propaganda, barking vicious dogs, choppers, sirens, floodlights, loud noises, UAVs [unarmed aerial vehicles for “peeping tom” surveillance], victims to target and lots of larceny. Their next step is to throw us all into their colonial jails and courts. These transplants keep trying to replace the Ongwehonwe of Onowaregeh. It hasn’t happened and never will. We keep popping up. The natural world has decreed that we shall always be here doing our job, taking care of the land, plants, animals, water and air.

The non-natives who are organized against us are not political. Otherwise they would be on our side. They would realize their own oppression and abuse by the colonists. The police hire provocateurs to mobilize them. They help set up situations that make it look good for the cops to come in.

They made the recent riot at Six Nations look like the OPP were protecting the Indigenous people from the angry vigilantes from Caledonia. This makes the conservatives start okaying money for more policing and more force against us. For the cops this means job security and more opportunity to take out vengeance on us.

It’s part of some big plan of a few people. It’s called “mobilizing the masses” to “harmonize the peripheries with the center”. The peripheries are Mexico and Canada and the center is the U.S., of course. They rile up society so they will get a bigger budget, be in greater demand and get control over everybody.

The center wants “death squad” type policing like in Chicago, New York, Toronto and Los Angeles, where they hit the people, do open racial profiling and are extremely corrupt internally. Is this happening in all Indigenous communities right now worldwide?

On May 29th Canada with their chief provocateur, Phil Fontaine, who wants to cash in on the re-enactment of the “Sand Creek Massacre”, are coming in with a plan to push the “final solution”. Watch out. Be ready!


Kahentinetha Horn - MNN Mohawk Nation News

Click News & See Category: “ CANADA "
Posted 4/28/08 8:30pm EDT.

St. John River expected to exceed historic flood levels

Increasingly, roads near Fredericton are being closed as waters continue to rise.

Increasingly, roads near Fredericton are being closed as waters continue to rise. (Submitted by James Whitehead)The water levels of the St. John River are now expected to reach or exceed the 1973 levels in Fredericton and Maugerville in the next 24 hours, New Brunswick's Emergency Measures Organization said on Wednesday.

Those levels are also expected to be reached in more southern areas as the crest moves down river.

The St. John River reached 8.6 metres in 1973.

EMO issued an alert to New Brunswickers on Wednesday afternoon that the river levels have reached a point requiring a "major flood warning to all areas along the St. John River."

The heavy rain fall has ended over the St. John River basin, but western parts of the province have received more than 100 millimetres of rain since Monday.

The water flows in the St. John River are increasing throughout the basin, with the greatest increase in the northern and middle portions.

Rain in northwestern Maine and southern Quebec, however, will flow downstream and raise the St. John River within the next 24 hours.

"That water is already on its way," said Andy Morton, deputy director of EMO. "We know the water level is going to come up substantially. For people in flood-prone areas, if they were flooded in 2005, they're going to be flooded again and maybe even in a larger area."

People living on the northern part of the river basin from Saint-François to Woodstock are also being affected by the flooding, Morton said. Approximately 20 families have been evacuated from Edmundston.

Roads across New Brunswick were being engulfed by water on Wednesday as rivers surged with rain and snow melt.

Roads in Bathurst, Miramichi, Saint John, Edmundston and Fredericton were under the flood waters that were funnelling into the province's rivers from southern Quebec and northwestern Maine.

Parts of the Trans-Canada Highway, including highway exits, are closed in the Sheffield, Edmundston and Saint-Jacques areas.

Flooding in New Brunswick is of grave concern, but all levels of government and emergency organizations are working well together and there is not yet a need to declare a state of emergency, said Public Safety Minister John Foran.

In the Fredericton area, sections of Route 105 are flooded and closed. Tripp Settlement Road, Rusagonis Road, Bass River Point Road and parts of Route 690 are also closed. The Gagetown ferry has stopped running because of the high waters.

Not a state of emergency: minister

Foran held a press conference in Fredericton on Wednesday to update New Brunswickers on the rising waters of the St. John River, which have reached 7.2 metres in the capital city.

A resident of Maugerville, N.B., tries to deal with some of the rising water around his property. Flooding could approach record levels, officials say.

A resident of Maugerville, N.B., tries to deal with some of the rising water around his property. Flooding could approach record levels, officials say.
(Submitted by Jacquie Anderson)

In neighbouring Maine, Gov. John Baldacci declared a state of emergency for Aroostook County on Tuesday night. Flood waters caused by melting snow and heavy rain have prompted the evacuation of 40 homes in the Fort Kent and Wallagrass area of the state.

Foran said New Brunswick is monitoring the flooding in Maine and Quebec carefully and will adjust the province's emergency response level as the waters continue to rise.

Alberta and Nova Scotia are prepared to send in help to the province, Foran said. The Canadian military is also on standby should there be a need for heavy vehicles or additional emergency support, he said.

Foran again urged New Brunswickers to heed the warnings of the province's EMO.

'Upset and disrupted' by flood, resident says

Mary Pacey, 93, has lived along the St. John River since the 1940s.

Pacey endured the 1973 floods and told CBC News that this spring's rising waters have her concerned.

"You're not very happy about things, you know," Pacey said. "You don't enjoy being all upset and disrupted."

Emergency officials have been going door-to-door in Fredericton and its surrounding region to make sure residents are prepared for the flood waters.

The owners of Wetmore's Nursery in St. Mary's, N.B., keep their sense of humour as the waters of the flooded St. John River take over the property.The owners of Wetmore's Nursery in St. Mary's, N.B., keep their sense of humour as the waters of the flooded St. John River take over the property. (Submitted by Shawna Powell)

For families living in the already flooded Maugerville area, women and children seem to be leaving their homes while men are staying to watch the rising waters and the sump pumps, CBC News' Nicolle Carlin said.

Many other people living in the affected areas are staying in their homes despite warnings that they may be stuck until the water recedes.

Emergency transport vehicles were being sent into already flooded areas around Fredericton on Wednesday afternoon to help residents who want to leave.

But once roads are closed to all traffic, officials will only enter flooded areas for emergencies, Morton said. Even then, it could take some time for officials to get to a flooded area, he said.

Evacuations have not been ordered though they are being recommended, Morton said, and emergency officials will try to persuade the ill and elderly in the areas outside of Fredericton to leave their homes on Wednesday.

Officials have six boats on standby that are expected to be put in the water Wednesday. Kayaks, canoes and Zodiacs are also sitting outside many homes in the low-lying communities to the southeast of the city.

Projections show more than 920 properties in the Fredericton area could be affected if the waters reach eight metres above sea level.

NB Power is warning residents and business owners that as the waters rise, power will be shut off in flooded areas.

The power is likely to be turned off in downtown Fredericton along Queen Street and on streets along the river on the city's north side, officials said. Residents are being urged to anticipate outages that could last several days.

Residents are also being warned to take precautions if they get their water from private wells. The water should also be tested and disinfected after the river recedes, officials said.

People who leave their homes are being told to contact a Red Cross registration centre that is keeping track of where people are moving to wait out the flood. Centres have been established in Burton and at the University of New Brunswick's Fredericton campus and 213 people have voluntarily evacuated their homes.

The university has also opened its residences for any families with nowhere else to go and has the capacity to accommodate thousands of people.

Emergency Measures is forecasting the following water levels:

  • In Fredericton, the water level is expected to exceed 8.6 metres by Thursday. Flood stage is 6.5 metres.
  • In Maugerville, the water level is expected to increase to 6.8 metres by Thursday. Flood stage is 6.0 metres.
  • In Jemseg, the water level is expected to reach 5.5 metres by Thursday. Flood stage is 4.3 metres.
  • In Grand Lake, the water level is expected to increase to 5.5 metres by Thursday. Flood stage is 5.0 metres.
  • In Sheffield-Lakeville Corner, the water level is expected to reach 5.6 metres by Thursday. Flood stage is 4.8 metres.
  • In Oak Point, the water level is expected to reach 4.6 metres by Thursday. Flood stage is 4.7 metres.
  • In Quispamsis and Saint John, the water level is expected to be 4.4 metres by Thursday. Flood stage is 4.2 metres.

Afghanistan update from Think Progress

Not Winning

In a press conference yesterday, President Bush said, "I think we're making progress in Afghanistan" -- days after President Hamid Karzai was the subject of an attempted assassination plot. The Interior Ministry said the Taliban, nearly vanquished from the country in 2001, admitted to launching the attack. These rounds of violence are the latest in what has been an eroding situation over recent years. The United States is also struggling to gain international support for the efforts in Afghanistan. "Many of them, I think, have a problem with our involvement in Iraq and project that to Afghanistan," Secretary of Defense Robert Gates said in February. While the United States has deployed a "new 2,300-strong reserve force" of Marines to Afghanistan, the country still does not receive the necessary attention. Karzai's escape "should serve as a wakeup call to shift the focus to a new front," Center for American Progress (CAP) Senior Fellow Brian Katulis wrote yesterday. CAP has recommended a multi-pronged approach to Afghanistan, including building the governnment, increasing security, jumpstarting reconstruction, reducing opium production, and removing terrorist sanctuaries through redeployment of troops.

WORSE IN 2008?: 2007 was the bloodiest year in Afghanistan since 2001, with 6,000 killed in the country. Maj. Gen. Jeffrey Schloesser, who commands U.S. forces in Afghanistan, said violence in 2008 "may well reach a higher level than it did in 2007," as insurgents pour in from Pakistan. "This year won't be different," he said. The attempted assassination of Karzai "came as the latest sign of a trend" that the insurgency in Afghanistan "is spreading from the Taliban stronghold of the south to the central and northern regions of the country," Christian Science Monitor reported this week. Furthemore, "[t]here is no security force in Afghanistan that people trust," according to member of parliament Ramazan Bashardost. He added that, after a recent attack, "the security forces fled the area before the ordinary people did." Afghanistan also has rates of illiteracy "among the highest in the world," a "weak and corruption-ridden government," and still retains the world's largest opium poppy crop.

BUSH CLAIMS WE'RE WINNING: Nevertheless, Bush remains blindly optimistic. "Do you think we're winning?" in Afghanistan, a reporter asked yesterday. "I do, I think we're making good progress. I do, yes," Bush said. But his leadership in Afghanistan has been anything but successful. The White House even "acknowledged that its strategic goals are unmet in Afghanistan in its own assessment late last year, but it has not yet implemented any major policy shifts on the Afghanistan front," Katulis noted. For example, according the Agency Coordinating Body for Afghan Relief, "Western countries have failed to deliver $10 billion of nonmilitary assistance pledged to Afghanistan over the last six years and the United States, by far the biggest donor, is responsible for half of the shortfall." Funding for Provincial Reconstruction Teams, which Bush "has called the leading edge of stabilization efforts," is "ad hoc and comes from so many sources that congressional investigators were unable to determine how much has been spent," a House Armed Service Committee report said last week. "[M]ilitary force, while necessary, is not sufficient to defeat militants in Afghanistan," Lawrence Korb and Caroline Wadhams of CAP wrote in January. Karzai has also criticized Bush's military-centric approach, which has caused heavy civilian casualties. "I am not happy with civilian casualties coming down; I want an end to civilian casualties," he said last weekend. "Overall, 42 percent of Afghans rate U.S. efforts in Afghanistan positively," down from 68 percent in 2005 and 57 percent last year, according to a December ABC News poll.

QUESTIONS FOR PETRAEUS: Bush recently tapped Iraq commander Gen. David Petraeus to lead U.S. Central Command, replacing Adm. William Fallon, whose premature departure in part stemmed from policy disagreements with the Bush administration. Appearing on PBS's NewsHour in January, Fallon pointed to the Iraq war as an explanation for the deterioration in Afghanistan. "[M]y sense of looking back is that we moved focus to Iraq, which was the priority from 2003 on, and the attention and the resources focused on a different place," he said. Petraeus is strongly associated with the current Iraq policy, which has drained spending and troop deployments away from Afghanistan. He now carries the responsibility of assessing priorities in Afghanistan as well as the entire Middle East. "Confirmation hearings for General Petraeus later this year offer an important opportunity for Congress to raise questions about how America can strike the right balance and match its considerable yet strained resources to the numerous threats it faces in Pakistan, Afghanistan and Iraq," Katulis notes. "It's time to separate out these two wars, or else we may lose both," Korb and Wadhams add.


Michael Bryant, MY MP, you represent PEOPLE not corporations!!

There is nothing lawless about these demonstrations.

Ontario is involved in CRIMES AGAINST HUMANITY

and creating political prisoners.

Compelling reasons to keep negotiating

Posted 3 hours ago

Six Nations people have been negotiating with the federal and provincial governments for two years over a land claim at Caledonia.

Tyendinaga Mohawks have occupied a quarry at Deseronto for more than a year as part of another land claim.

And last year, people of the Ardoch Algonquin First Nation took over land near Sharbot Lake, protesting a proposed uranium mining operation. That protest resulted in the jailing of Bob Lovelace.

There are common themes running through all three situations:

they are contentious developments that are opposed by the local natives, and sometimes their non-native supporters;

natives accusing the provincial government of not negotiating with them in a timely manner;

protests spilling over onto public roads;

arrests by OPP officers often involving violent clashes;

Ontario Provincial Police telling the public they will deal only with the public disturbances, not the land-claim issue;

the provincial government saying it will deal only with the land claims, not the disturbances.

The manner in which the province and the provincial police have been dealing with these situations is guided by one crucial lesson: the fatal shooting of native protester Dudley George in 1995 by an OPP officer during the Ipperwash standoff.

This is a good thing. We don't want any more deaths or bloody confrontations. But this also places a greater onus on native groups to be responsible.

Last week, Tyendinaga Mohawks erected a blockade on a busy highway. Police moved in and took it down peacefully.

On Friday afternoon, protest leader Shawn Brant was arrested and charged with various crimes not related to the blockade. A group of his supporters moved in, smashing a police cruiser's window and injuring two officers.

By Friday night, Six Nations Mohawks had thrown up a blockade at a highway interchange near Caledonia in support of Shawn Brant.

Brant and the Tyendinaga protesters, meantime, were essentially disowned by the band council. "There must be an end to road blockades, violence, and any conduct that has the potential to further inflame the situation," said Chief Donald Maracle.

Confused? Many Ontarians are frustrated with these eruptions of lawlessness, but also with the lack of progress in land claims talks.

The opposition Conservatives this week pressed Michael Bryant, the province's aboriginal affairs minister, to cut off all talks until the barriers in Caledonia were removed. Bryant replied: "

If there is not negotiation taking place and the parties aren't talking, then how on Earth would progress be made?"
Recently, Bryant said negotiations were on again.

It is precisely Bryant's job to keep all sides at the table. The reasons for urgent action are compelling: heightening native and non-native tensions; violent clashes between police and natives; radical native groups hijacking the agenda from legitimate representatives; and good people like Bob Lovelace being detained for peacefully standing his ground.

Article ID# 1006938

By the time the summer is over, there will be a tent city in DC - martial law or not.

http://therealnews.com/web/index.php?thisdataswitch=0&thisid=1421&thisview=item

US truckers call for nation-wide shutdown

Truckers' protest urges Congress to stop subsidizing oil industry and build new refineries

Wednesday April 30th, 2008

A convoy of trucks rolled through Washington, DC, on Monday, as part of a protest to pressure Congress into acting on high gas prices. As gas around the US hit an average of $3.66 per gallon--a full 66 cents above the price this time last year--truckers called on the US government to take action.

With the Truckers in DC - Barbara Ehrenreich


Truckers live in an alternative dimension, at least so I conclude when trying to figure out how to meet up with the convoy of trucks coming into to DC to protest high diesel fuel prices on Monday. JB, aka Mike Schaffner, one of the organizers of the action, calls early in the morning to suggest various highway intersections, and I have to explain there's no way a pedestrian can be just standing on one the super-highways around DC. We eventually settle on a spot in a desolate area of southeastern DC, but even so, I probably couldn't have made the connection without the genes of a grandfather who rode the rails. When I hear the honking, low and steady, and see the first trucks rising out from an underpass, I scramble up to a narrow walkway along their route and start waving frantically. Everyone waves back nicely, and about the fifth truck actually stops. It's JB and I leap aboard.

JB and I have become friends-by-phone in the weeks since I blogged about the first truckers' protests in the beginning of April, but all I knew about him as a physical presence is that he always wears a black cowboy hat. Its brim is turned down, locating him in Larry McMurtry's rather than John Wayne's West, and his eyes twinkle deeply when he smiles, which is pretty much all the time. Everything seems to delight him: Being in DC for the first time, having 250 trucks behind him, the friendliness of the tourists on the street as we inch our way toward the Mall.

Since he hasn't been home in Texas since January 1, this -- the "bobtail" of a truck based in New Jersey -- is JB's world. There's a neatly made bed behind our seats and a laptop that can swivel into view while he's driving, as well, of course, as a GPS, a cell phone and CB radio. From this little control room, which is also a workplace and a living space, JB has helped assemble the hundreds of truckers and their families who are with us now. It's a life stripped bare: He ordinarily eats only one meal a day (nothing fried or from a buffet), sleeps rarely (just an hour and half last night), and drinks no coffee ("it leads to stops") but admits to an occasional Red Bull.

We circle the Mall, slowly, triumphantly, twice. It's hard to talk over the honking and the excited CB chatter, but JB wants to know if I've ever been at a demonstration in DC before. Ah, I explain, I go back to the 60s, but the most recent one was an anti-war demonstration organized by the women's group Code Pink. He laughs, making me think he finds the name amusing. But no, he shows me he has Code Pink in his cell phone. They had contacted him and will be joining us at the rally at the Capitol.

We are to park the trucks at the RFK Stadium and walk from there to the Capitol, giving us about a half an hour to mill around on foot in the parking lot first. There's a bobtail with "Truckin for Jesus" painted on it and, under that, "Truckers and Citizens United." There are Operation Desert Freedom caps and a POW/MIA flag, as well signs indicting oil companies and "Wall Street speculators." I chat with members of the mostly African-American contingent of DC dump truck drivers and with Belinda Raymond, a trucker's wife from Maine, who tells me that people in her area raised $9000 to send a convoy of trucks down here, with the Knights of Columbus accounting for $2500 of that. Whole families have come, and I see a boy carrying a sign saying "What about My Future?" A smartly dressed woman from New Jersey carries a sign asking, "Got Milk? Not Without a Truck."

If there's an ideology at work here I'd call it small-d democratic fundamentalism: We own the government, we pay for it, and now it better do something for us. In fact, JB is carrying hundreds of copies of the Code of Ethics for Civil Servants he's downloaded from the internet to hand out at the Capitol and remind Congress of their duties. The only time I see his smile fade is when the protest's media coordinator -- contributed pro bono by the liberal think tank The Institute for Policy Studies -- lays down the ground rules for a meeting with Senator Jeff Sessions (R, AL) scheduled for the afternoon. "But he works for us!" JB protests.

On the 45 minute long march from the stadium to the Capitol, things degenerate toward the level of farce. No one had counted on the rain, which is back in force, or on the fact that, as one guy puts it to me, they're "truckers, not walkers." JB, I and a few others fall behind because JB insists on running back to his truck and changing into a shirt printed with the American flag and Constitution. Our little band includes Mike Groff, a heavily pierced 20-something from Pennsylvania who is one of the original organizers of the protests and his pregnant wife Melissa. JB and Mike take turns pulling a wagon carrying batteries for the sound system that will be used at the rally. The rain turns into a torrent. We trudge through the ghetto, then on into a middle class neighborhood sporting azaleas and Obama lawn signs, not entirely sure of our direction and soaked to the skin. Melissa reassures me that, if we pee our pants, which seems increasingly likely, no one will notice.

But things look up when we get the Capitol, thanks largely to Senator Susan Collins (R, ME), who arranges for the truckers to stage a press conference inside the Russell Building lobby and out of the rain. Three truckers -- two white and one black -- speak about their dwindling livelihoods and the need for immediate government action to push down fuel prices. I can't fight my way through the media to hear much of what they're saying, but one speaker mentions foreclosures. This is a wide-ranging cry from the strangled middle class -- or working class or whatever you want to call it -- and all I can think is:

Where are the Democrats? Why aren't they are pouring out of their offices to show support for the truckers?
And wouldn't have been wonderful if Obama had shown up? Because he's not going to make it unless he learns to channel the frustration of people like JB, Melissa and Mike.

That's just my concern though. The whole event has been strictly nonpartisan. The truckers are already focused on the May 1 Truckers and Citizens United protest in New York City (see www.theamericandriver.com). That one, JB tells me, will be in solidarity with the San Francisco longshoremen's May Day actions against the war.


April 29, 2008

Khadr lawyer urges Canada to repatriate 'child soldier'

Juliet O'Neill , Canwest News Service

Published: Tuesday, April 29, 2008

OTTAWA - With opposition parties united in a call for the government to bring Omar Khadr home from the U.S. military prison at Guantanamo Bay, Cuba, the young man's Pentagon-appointed lawyer championed the unusual case of the "child soldier" at a Commons committee hearing Tuesday.

U.S. navy Lt.-Cmdr. William Kuebler's appeal for Canada to save Khadr from a potential life sentence from a U.S. military commission appeared to leave the Conservative government unmoved. Secretary of State Jason Kenney defended the government's "consistent" position of not interfering in the U.S. process governing terrorist suspects.

Kuebler emphasized that every other western country has repatriated their nationals from the prison built for "enemy combatants" in the war on terror; that all youth except Khadr were segregated in a children's wing called Camp Iguana; and that evidence he killed a U.S. soldier with a grenade during a 2002 firefight in Afghanistan was recently undermined by a contradictory account of what took place.

Wayne Marston, the New Democratic Party MP who proposed the motion for hearings into Khadr's case, reacted to Kuebler's testimony by accusing the government of abandoning a boy caught in "absolutely horrendous" circumstances. Khadr has been detained without trial for six years, since age 15, when he was captured by U.S. special forces.

Marston insisted Khadr be treated as a child soldier under a United Nations protocol - signed by Canada and the United States - that regards children recruited for war as victims and calls for their rehabilitation, rather than punishment.

Kuebler portrayed Khadr as a young man who is daring to dream of a life in Canada, his country of birth, where he can watch movies such as Lord of the Rings and visit the Rockies, get an education and a job and embark on an ordinary life. He speculated the government won't champion his cause because the public doesn't approve of the association between al-Qaida and some of the Khadr family members, including Omar's parents and sister. He should not be punished for the views and deeds of others, he asserted.

Marston questioned why the government is not prepared to secure Khadr's release when it is working on Brenda Martin's release from a prison in Mexico. Kenney said the cases are "not analogous."

When a reporter asked if Khadr is a child soldier, Kenney added that he now is 21 years old and that an optional protocol of United Nations Convention on the Rights of Children does not bar prosecution of persons age 15-18 in any case.

"We've pressed the American authorities to ensure he received proper care and we've asked that they take into account his age," Kenney said.

If he is tried by a U.S. military commission, Kuebler predicted Khadr will be found guilty and sentenced to life in prison "for little more than having survived a fire fight."

Kuebler's testimony came after former Liberal foreign affairs minister Bill Graham publicly expressed regret that the previous government did not press harder to repatriate him.

Ottawa Citizen




Former Prime Minister Paul Martin is too ashamed to show face in Parliament because of role in North American Union agenda


by Peter Tremblay
Paul Martin


Paul Martin needs to confess to Canadians about his role in a neo-colonial initative of the U.S. Bush administration to take-over Canada.

In the article titled "Martin should resign as MP, Layton says" by Elizabeth Thompson, that was published in the Montreal Gazette on 2 April 2008 "New Democratic Party leader Jack Layton, is calling on former Prime Minister Paul Martin to resign as a member of Parliament, saying residents of LaSalle-Émard deserve an MP who is going to actually show up in the House of Commons." But there is an apparent basic explanation why Paul Martin has not been in Parliament. If you were an Member of Parliament or even more so, a former Prime Minister, who signed an Agreement to sell out your country, without informing that nation, and if you felt guilty about it afterwards, how would you feel, after that, about taking your seat in Parliament? You would probably seek to stay as far away as possible from re-taking your seat in Parliament, and would busy yourself, as much as possible, with other issues that by help soothe your conscience. Indeed, this is exactly, what Mr. Martin seems to be doing.


http://www.agoracosmopolitan.com/home/Frontpage/2008/04/17/02332.html

Top Neocon Calls For Destruction Of Constitution

04-16-2008
www.roguegovernment.com
Lee Rogers



n a recent edition of the Austin-American Statesman a book review of Phillip Bobbitt’s new book Terror and Consent goes into how the book calls for the shredding of the Constitution. The article written by James E. McWilliams features an image of the Constitution being torn with a big bold headline that states “Everything must go.” The words “How to Fight Terrorism”, are put in place of where the Constitution is torn. The article is blatant propaganda to make people think that the answer to fight terrorism is to destroy the Constitution. As disgusting as this is, the contents of Bobbitt’s book advocates exactly what the picture depicts. Bobbitt endorses using nongovernmental organizations and multinational corporations to take over the roles and functions of nation states. He also endorses giving the United Nations the authority to wage war without approval from the Security Council and the use of non-lethal chemical weapons to fight terrorism. If he really wanted to end terrorism using non-lethal chemical weapons, he should be endorsing the use of non-lethal chemical weapons on the headquarters of the CIA, British Intelligence and Mossad because that’s where the majority of terrorism comes from. Of course, Bobbitt won't mention that fact.

Let’s look at a blurb from the Austin-American Statesman article that gets into some of the things that Bobbitt endorses in his book.

Bobbitt’s previous book, "The Shield of Achilles," explored the grand themes of warfare and state development, marking his penchant for the magnum opus. At nearly 700 pages (including more than 100 pages of notes), "Terror and Consent" follows suit, taking on a similarly big picture. If "we want to defeat state-shattering terror in the twenty-first century," Bobbitt writes, we will have to "transform the emerging constitutional order of the twenty-first century State."

Specifically, we must stop thinking like a nation state and start thinking like the "market state" that we are inevitably becoming. The nation state — a constitutional order dedicated to protecting and improving the material welfare of its citizens — served the United States well from the mid-19th century to the end of the Cold War. But Bobbitt contends it’s vulnerable to a new battery of threats. The accessibility of weapons of mass destruction, the globalization of international capital and the "universalization of culture" have eroded the conventional borders that once legitimated national security.

What’s needed is a constitutional order that takes its structural cues from multinational corporations and nongovernmental organizations, relying "less on law and regulation and more on market incentives" to expand people’s options. Such a market state keeps its finger on the pulse of consumer demand, advocates trade liberalization, is prone to the privatization of public works and "will outsource many functions." In the seminar rooms of political science departments this change is referred to as "neoliberalism" (on the streets, it is known as "globalization") — and Bobbitt, who is a geopolitical realist, believes we have no choice but to embrace it.

Simply put, Bobbitt is endorsing what the elites have long sought after and that’s a New World Order or a global government. Bobbitt advocates the destruction of the Constitution and the transfer of power to multinational corporations and nongovernmental organizations. This man is a traitor. In the New World Order that the elites envision, people will only have the illusion of choice via phony democratic rule. Real decisions will be made by multinational corporations and nongovernmental organizations behind the scenes. Unfortunately, what Bobbitt advocates is already happening considering initiatives such as the Security and Prosperity Partnership which seeks to dissolve the national borders between the Canada, United States and Mexico.

Bobbitt also endorses preemptive use of force by the United Nations without a Security Council authorization as well as the use of non-lethal chemical weapons to prevent terrorism. This is confirmed from a blurb in the Austin-American Statesman.

Bobbitt believes that the UN Charter should be amended to allow the preemptive use of force without a Security Council authorization, that the Geneva Conventions should be changed to forbid the indefinite containment of terrorist prisoners without trial and that we must, in cases in which the use of non-lethal chemical weapons could be used to prevent terror, be able to redefine such methods as "counterforce measures."

What is not mentioned in the article is what sort of non-lethal weapons he would advocate using. Considering that the public is having pharmaceutical drugs and fluoride dumped in their water, mercury put in their vaccines, pesticides sprayed over populated areas and all sorts of other horrors one has to ask if Bobbitt would endorse these methods to fight terrorism?

The war on terror is a proven fraud which makes Bobbitt’s book entirely irrelevant. He bases all of his conclusions off of something that is a lie. Bobbitt also refuses to acknowledge mainstream history which shows that anytime power is concentrated in the hands of a few it always turns out badly. Power corrupts and absolute power corrupts absolutely, and the New World Order is seeking to gain absolute power. If they are successful in achieving this, we will see a tyranny like no other. The New World Order will be a global enslavement system in which advanced technology is used to dominate the people of the world. It is disgusting that Bobbitt prefers a system that concentrates power in the hands of the unelected few over the freedom and inalienable rights guaranteed by the Constitution. It is insane to say that the Constitution is outdated and a new form of governance is required in the 21st century. Free speech, the right to bear arms, the right not to have your home searched and personal belongings seized without a warrant are concepts that are just as applicable in the 21st century as they were in the 18th, 19th and 20th centuries. Bobbitt is an elitist hack and a traitor for the statements he is making in his book. While he has every right to say these things under the First Amendment, his statements undermines everything that has made this country special. What he doesn’t realize is that the New World Order will dispose of him like they will everyone else when they see that he is of no further use to their insanely corrupt and tyrannical system. Bobbitt is nothing more than another useful idiot for the New World Order enslavement system and he isn’t as smart as he thinks he is.

Below is Bobbitt’s contact information if you’d like to express your displeasure at his anti-American and pro-NWO statements.

Phone: (512) 232-1376
Fax: (512) 471-6988
E-mail: PBOBBITT@LAW.UTEXAS.EDU

Martial law soon?

MAYDAY ALERT!
—Terror Drills Could Go Live
!

See my ignored article, http://www.opednews.com/articles/opedne_ladybroa_080414_martial_law_21_earthqu.htm


Dr. James H. Fetzer
Major William B. Fox
Captain Eric H. May
SFC Donald Buswel1


April 26, 2008

The name "false flag" comes from the old pirate's ruse of flying another country's flag during an attack, thereby shifting blame for the attack to a party that had nothing to do with it. Governments use false flag attacks to push their nations into dictatorship or war. As military experts, we fear that national terror drills, scheduled for May 1-8, could be used to camouflage a false flag attack in the United States.

Strategic Signals

Dr. James Fetzer

Yesterday an American-flagged ship fired on the Iranian Navy, and now Pentagon sources say that they have been ordered to prepare attack plans. Admiral "Fox" Fallon, the Centcom commander who opposed war with Iran, has been ousted in favor of Bush loyalist General David Petraeus, who has spent the last month accusing Iran for our increasing problems with the Iraqi resistance.
Saudi Arabia has been preparing for nuclear fallout from an attack on Iran since last month, when Dick Cheney paid a visit. Israel has just finished its largest-ever domestic war drills. Israel and the Bush administration are insisting that Syria and North Korea are nuclear collaborators. Syria is preparing for the contingency of an Israeli attack. Iran is preparing for the contingency of a US attack. US government insiders speculate that Bush has promised Israel an expanded Middle East war before he leaves office.
The Neo-Cons are pounding their war drums again, according to Dr. James H. Fetzer, the founder of Scholars for 9/11 Truth, and he believes that nothing would help them spread their imperial war in the Middle East as much as another 9/11.
He has just published "9/11 and the Neo-Con Agenda."
http://www.amfirstbooks.com/IntroPages/ToolBarTopics/Articles/Other_Topics/9-
11_Anomalies/Dr._James_H._Fetzer_2008-04-22_9-11_and_the_Neo-
Con_Agenda.html
The article is a must-read introduction for anyone wanting to understand the origins and aims of the "global war on terror."

Domestic Discord

Capt. Eric H. May

Inside the US, Bush approval ratings are well below 30%, and approval ratings for the U.S. Congress and mainstream media are even lower. Over three quarters of the American people believe that the country is on the wrong track, and just as many want to end the quicksand war in the Middle East. The economy is crashing as fuel prices are skyrocketing. The Establishment is losing its grip on power. It would take another 9/11 to make the nation forget its domestic woes and resume its lost zeal for the Neo-Con "new American century" of foreign wars and a domestic police state.
In his much-discussed February article, "False Flag Prospects, 2008," http://www.thepriceofliberty.org/08/02/25/may.htm Captain Eric H. May documented the disturbing fact that military and police exercises were occurring at the same time as the 9/11 US attacks in 2001 and the 7/7 UK bombings in 2005. In that prescient article, he designated the Pacific Northwest as one of the top three target zones for the next US false flag attack, and the Pacific Northwest will be the target of terror drills May 1-8.
Should a major event occur during the drills, the Bush administration is prepared to implement National Security Presidential Directive (NSPD) 51, which establishes dictatorship "in the event of a man-made or natural catastrophe." It is an extraordinary measure, and the White House has stonewalled Homeland Security Committee members from the House of Representatives who wanted to read it. One of those members, Oregon's Peter DeFazio summed up the feeling of many Americans about NSPD 51 when he said "Maybe the people who think there's a conspiracy out there are right."
Fears that a false flag attack might result in martial law are nourished by last week's militaristic Operation Sudden Impact, reported by Infowars.net writer Steve Watson: "Three States Subjected to Martial Law Sweeps"
http://www.infowars.net/articles/april2008/180408impact.htm

National Level Exercise 2-08

Maj. William Fox

NLE 2-08 will involve the very highest levels of Homeland Security and the US Northern Command. Both "Homesec" and "Northcom" were established by the Bush administration in the wake of 9/11 to take control of the nation in the event of another terrorist attack. They will be joined by FEMA in the May 1-8 exercise, which is one of the two largest terror drills scheduled this year.
On Thursday, May 1, the exercise begins in Washington, when an explosion collapses the Alaska Way viaduct in downtown Seattle and damages surrounding buildings. Twenty minutes later, terrorists explode a highjacked tanker filled with highly toxic chemicals at the Seattle Ferry Terminal. Deadly gas soon permeates downtown Seattle.
Emergency responders come in waves. Police and firemen, first to arrive, are quickly overwhelmed. The state deploys its 22-member Civil Support Team, a National Guard unit, to assess the damage and coordinate support. Later, 100 soldiers from a chemical battalion based in Yakima arrive to rescue, decontaminate and treat survivors. Finally, 5,000 troops arrive to handle logistics and security.
On Monday, May 5, the scenario shifts to Oregon where VX, the most toxic nerve agent ever synthesized, erupts from the Umatilla Army Depot.
The next day, terrorists blow up a chemical tanker in Ferndale, Washington. The county sheriff requests national support, and a Marine Corps chemical warfare detachment temporarily based at Ft. Lewis, Washington for the exercise responds.
According to sources at Northcom, NLE 2-08 will involve "robust play," with "surprise injects" of unanticipated events in which participants are "stretched to the limit" and have "everything thrown at them except the kitchen sink." All of this makes it easier for the exercise to "go live" by having a real catastrophe occur.
As the Pacific Northwest scenario is playing out, Washington, DC will be simulating a catastrophic hurricane as part of the same exercise. It wouldn't be much of a stretch to suggest that this puts Dick Cheney back in the bunker he occupied during 9/11.
Citizens interested in understanding how local, state and national levels of the military can be manipulated into working against us should read "The Real Drill" by Major William B. Fox, about Portland area terror drills last year.
http://www.lonestaricon.com/absolutenm/anmviewer.asp?a=2006&z=186

Mission of Conscience

SFC Don Buswell

Many American citizens are deeply concerned about police militarization, and about government and media preconditioning of our nation for future terror attacks and martial law. We recommend that they monitor NLE 2-08 closely. Armed with cell phones, cameras and the Internet, they are the single greatest deterrent against false flag terror.
If we, the co-authors of this alert, are in error about anything, then we invite reasonable officials to investigate us and our assertions at the very highest levels. In the past we have too often met with hostility, evasion or deception by officials involved in terror drills. We have been stonewalled when we have requested access to an extended schedule of unclassified military and police terror drills.
We believe that there is a pattern of official retaliation against patriotic service members who ask questions about 9/11 and false flags.
In 2006, Sergeant First Class Donald Buswell, an Army military intelligence NCO, suggested that 9/11 might have been a false flag operation. Within a month the decorated 40-year-old Iraq war veteran suffered a freak pulmonary embolism, which nearly killed him. After he was released from the hospital, his command accused him of disloyalty for his remarks, and subjected him to an extensive military investigation. Ultimately, he was fully exonerated, and the now-retired Buswell has become widely known on the Internet as the "9/11 NCO." Stephen Webster, writing for The Lone Star Iconoclast, gained national attention with his story about Buswell, "Under Fire! U.S. Army Intelligence Analyst Targeted for Suggesting New Independent 9/11 Investigation."
http://www.lonestaricon.com/absolutenm/anmviewer.asp?a=426&z=40

The duty to keep the government honest isn't optional for those of us who have taken an oath to defend the Constitution against all enemies, foreign and domestic. It has always been difficult, and even dangerous, to serve the American people. We call on all active-duty soldiers, police and first responders to obey their oaths by asking questions that need to be asked, and by thinking twice before blindly carrying out orders that may result in an a false flag attack against their country. We urge leaders of those soldiers, police and first responders to explain that diligence is not disloyalty, and that no one ceases to be a free American citizen by putting on a uniform.
Issuing an alert—as we are doing now—is not an instance of "crying wolf," as Bush administration apologists often assert. As military-trained experts, we are convinced that the US 9/11 and UK 7/7 attacks were set up under the camouflage of terror drills. The existence of a wolf is not in question. The wolf of false flag terror has killed our fellow citizens and frightened our country into needless wars. It's our mission of conscience to keep it from striking again.

* * * * * * *

Dr. James H. Fetzer and Major William B. Fox are former Marine Corps officers. Captain Eric H. May and Sergeant First Class Donald Buswell are former members of Army intelligence.

References:

Additional Commentary Regarding NLE 2-08:
"Is the primary WMD terror target Seattle, or Portland, Oregon once again?
" by Maj. William B. Fox.
"The Timing of a Possible False Flag Attack During NLE 2-08" by Captain Eric H. May
FEMA Upcoming Exercises web page; for the 26 April 2008 FEMA web page archived by America First Books that describes the 1-8 May 2008 National Level Exercise 2-08, please click here.
Dynamic Duo Show, Genesis Communications Network, 24 April 2008. Dr. James H. Fetzer, founder of Scholars for 9/11 Truth, interviews Captain Eric May in the first hour, and both Capt May and Maj William Fox in the second hour. They discuss how the Bush administration and Israel are manuevering America towards war with Iran, and the background behind their alert regarding the 1-8 May NLE 2-08 exercise that "war games" a WMD attack against Seattle. This includes an analysis of ways that this exercise could get highjacked like the 9-11 exercises.
1st Segment, 52:51, 6.2 MB
Download Here.
2nd Segment, 52:51, 6.2 MB
Download Here.

Editor's Note:
To see the online version of this article published by the Lone Star Iconoclast, please click here.

Smith Media, Inc.
http://www.lonestaricon.com/.
Support The IconoclastSubscription Link


Three States \Subjected To "Martial Law Sweeps"


Local, state police and sheriff's office join feds for "terror" sweeps that result in hundreds of citations for traffic violations

Steve Watson
Infowars.net
Fri
day, April 18, 2008







Federal law enforcement agencies co-opted sheriffs offices as well state and local police forces in three states last weekend for a vast round up operation that one sheriff's deputy has described as "martial law training".

Law-enforcement agencies in Tennessee, Mississippi and Arkansas took part in what was described by local media as "an anti-crime and anti-terrorism initiative" involving officers from more than 50 federal, state and local agencies.

Given the military style name "Operation Sudden Impact", the initiative saw officers from six counties rounding up fugitives, conducting traffic checkpoints, climbing on boats on the Mississippi River and doing other "crime-abatement" programs all under the label of "anti-terrorism".

WREG Memphis news channel 3 reported that the Sheriff's Department arrested 332 people, 142 of whom were fugitives, or "terrorists" as they now seem to be known.

Hundreds of dollars were seized and drugs recovered, and 1,292 traffic violations were handed out to speeding terrorists and illegally parked terrorists.

Click here to watch a WREG Memphis news report

The authorities even raided businesses and store owners, confiscating computers and paperwork in an effort to "track down possible terrorists before something big happens".

The Sheriff's Department is determining if and when they plan another round-up.

The operation, which involved police, deputies, the FBI, drug agents, gang units and even the coast guard, is just one example of how law enforcement at the state and local levels is being co-opted and centralized by the Department of Homeland Security via massive federal grants.

It also highlights how the distinction between crime and terrorism is becoming irrelevant

An Infowars reader called in to the Alex Jones show yesterday to alert us to the story and explain that he had gleaned the information from a his friend, a sheriff's deputy in Memphis, who had described the operation as "training for martial law in America".

Forget innocent until proven guilty, you are now a terrorist suspect until you are told otherwise.

It is now the norm to consider everybody equally likely to be guilty of something than innocent. This is proactive policing, not preventative or reactive policing, and is widely indicative of a society that is NOT free.

This form of proactive policing is a phenomena indicative of a once free state rapidly declining into a authoritarian police state.

If there was a real terror threat in these states, it would surely make sense to for law enforcement agencies to target known trouble areas, and follow up on already existing leads. Instead we are seeing local police and the coast guard being recruited to randomly target anyone in any area as possible terrorists.

Surely if there was a real terror threat, this activity would harm the effort to combat it.

Of course, such activity is clearly not related to a real and tangible terror threat, it is related to the ongoing effort to vastly increase the size and scope of the federal government and increase the power it has over American citizens.

The information and intelligence from the operation will be collated and routed through federally funded state-run fusion centers, which are working in conjunction with the military arm of the DHS, NORTHCOM.

Such information will soon include the DNA and other biometric information from every person arrested, which DHS head Michael Chertoff has declared is no longer your personal information.

We recently reported on the fact that after 9/11 the Justice Department advised the Bush administration that it was able to effectively suspend the Fourth Amendment where domestic counter terrorism operations are concerned.

In light of this, and given that the government has begun to class any crime as terrorism and set local and state police to work on "anti-terror" operations, it is clear that the protections provided by the Bill of Rights and the Constitution are under direct threat.

We have seen how new provisions will effectively nullify the U.S. constitution, and a recent spate of executive orders, in particular PDD 51, outline preparations for the implementation of open martial law in the event of a declared national emergency.

Centralized and federally coordinated law enforcement programs complement nationwide FEMA programs to train Pastors and other religious representatives to become secret police enforcers who teach their congregations to "obey the government" in preparation for the implementation of martial law, property and firearm seizures, mass vaccination programs and forced relocation. The effects of this particular program have already been witnessed.

These were the last earthquake warnings I posted (and ministers are who are being trained to handle the earthquakes AND martial law.)


Fault lines may threaten Victoria, Abbotsford
Globe and Mail - Canada
This could turn out to be a very big fault that is fundamental to the way earthquakes develop in this part of Washington and southwestern British Columbia. ...
See all stories on this topic

Earthquake risk on North Olympic Peninsula detailed by scientists
Peninsula Daily - Port Angeles,WA,USA
The main danger is to Abbotsford, British Columbia, a city of about 175000, said Craig Weaver, the Pacific Northwest earthquake coordinator for the USGS. ...
See all stories on this topic

AMERICAS NEWS AT 0500 GMT
PR-Inside.com (Pressemitteilung) - Wien,Austria
ABBOTSFORD, British Columbia _ The floor of a church filled with a mostly teenage audience of about 1000 people collapses during a concert, ...
See all stories on this topic

Google Blogs Alert for: British Columbia earthquake

Are you earthquake ready?
By Raj Dhaliwal (MyAbbotsford.Com) (Landmark...(Raj Dhaliwal (MyAbbotsford.Com) (Landmark...)
Two new earthquake fault zones have recently been discovered. One fault line is close, and could cause significant damage to Abbotsford BC. Newly released seismic hazard maps from the US Geological Survey feature the Boulder Creek Fault ...
Raj Dhaliwal - Abbotsford BC... - http://activerain.com/blogs/rajdhaliwal


THE WEST SIDE USA / CANADA... 4-26-08 TO 4-30-08
By nightangel7246(nightangel7246)
CHILLIWACK BC LOCATION... SHOWING MORE INCREASE PASSING ACTION OF UNDER GROUND MOVEMENT COMING IN FROM THE SHORE LINE AREA. IT'S A STAGE LEVEL OF 2 ALREADY IN PROGRESS. MORE SHARP PULSE ACTION IS NOW SHOWING. ASHNOLA RIVER. ...
EARTHQUAKES... THE UNDER GROUND... - http://journals.aol.com/nightangel7246/EARTHQUAKES/



Photo of main CDC campus in Atlanta, GeorgiaEmergency Preparedness and Response:
What CDC Is Doing

Preparing people for emerging health threats is one of CDC's overarching goals. CDC contributes to national, state, and local efforts to prepare for and prevent public health disasters before they occur. When a disaster has occurred, CDC is prepared to respond and support national, state, and local partners in responding in order to improve public health outcomes. After response to a disaster has ended, CDC assists national, state, and local partners in the recovery and restoration of public health functions.

Overview

Video: A New Era of PreparednessA New Era of Preparedness NEW! Mar 27, 2008
A video presentation of what CDC is doing to ensure you and your family are safer and healthier in these ever-changing times. Preparing people for emerging health threats is one of CDC's overarching goals.

CDC Organizations and Programs

Organizations and programs across CDC are working to improve emergency preparedness and response. These include the following:


Chertoff To Demonstrate “Checkpoint Evolution” at Airport

Associated Press
April 28, 2008

LINTHICUM, Md. (AP) ― U.S. Homeland Security Secretary Michael Chertoff is scheduled to visit BWI Thurgood Marshall Airport Monday to announce changes at airport security checkpoints.





Chertoff will demonstrate what is called “Checkpoint Evolution.”

The Transportation Security Administration Web site features videos to explain the features and goals of the equipment.

According to the Web site, the checkpoints will feature soothing music to calm passengers, easy-to-read signs and Plexiglas conveyor belts allowing passengers to see their luggage move through the inspection process.

April 28, 2008

- The Activism at Six Nations today - neocolonialist version

Protesters refuse to clear Hwy 6


1 2
Ted Brellisford, The Hamilton Spectator.
click here to expandNatives gather below Highway 6 bypass at 6th Line Saturday ...
April 28, 2008
The Hamilton Spectator

CALEDONIA - Native protesters blocking the Highway 6 bypass in Caledonia are refusing to clear the road.

Spokesman Bryan Skye said Ontario Provincial Police asked this morning that barriers blocking each end of the bypass be dismantled. Protesters refused and say they’ll keep the road closed until police stand down from a confrontation in eastern Ontario.

Haldimand County Mayor Marie Trainer says some residents have already talked about taking the law into their own hands to end the Six Nations highway blockade.


Trainer says the renewed blockade is forcing motorists to go through Caledonia, straining a heritage bridge which is up for repairs in a few weeks.

She says it's putting even more strain on residents, some of whom have gathered near the occupation site to discuss taking action on their own.

The OPP and Mohawks have been staring each other down in Deseronto since Friday, when a native leader was arrested for breaching a court order.

Police removed a barrier blocking a road there at about 8.30 a.m. Natives at the Caledonia blockade said it was unmanned and that there was no violence. But a spokesman said the local blockade will continue until the standoff over an occupied quarry in Deseronto is resolved.

Skye said the Hwy 6 blockade is not connected to land claims issues in Caledonia
Instead, he said it is a show of support for Mohawks in eastern Ontario. Skye said is now part of a wider strategy among members of the Six Nations confederacy.

With files from The Canadian Press


Watch the video




ACTVISM SUPER ALERT: Help out the Lake Ardoch protestors TODAY

Please circulate this WIDELY
Ladybroadoak.blogspot.com

to find out what is needed, press on the links below!!!

This is merely some media and go
vernment link information.

Much is needed to help out today!


First off - if anyone wants to come up, my apartment is available!! I will even drag my poor aching body around to clean it up. Creator will give me the strength, I am sure. You can leave a comment on the comments section if you see this.

Read on to see what is need urgently NOW.

This is definitely serious!! Anyone, anyone who will help out is welcome to accept what is extremely humble hospitality.

Once before when RAN had a LIVE demo at Queen's Park, he took the Premier's website down and the telephone lines were TURNED OFF, just last fall. Dalton McGuinty's cousin, FRANK, is one of the primary benefactors of the du and edumping monies!!

I did some checking with Lauren Moret this weekend to figure out the power that be's plans for Canada and particularly Ontario. What she told me only confirms what I already KNOW. There is HUGE MONEY RIDING on shutting DOWN THESE PROTESTS; they sure need EVERYONE'S help and they need it today. She is on here way to a speaking tour in Canada right now. Lauren Moret had me do my lowlevel radiation blog.

Canada is the ruling class' river of nuclear destruction; CN RAIL is one of the 30 corporations set up to run North America. Their head, Hunter Harrison, changed CN rail to hauling all sorts of Nuclear Waste - This is why CN rail went after Shawn Brant. And now they REALLY have him. He goes to court this morning and that is why the ptb are trying to split up OUR forces today. The press firmly sealed its lips about all this abuse over the weekend including the CBC, which we bloody pay for. OUTRAGEOUS. Comeco has done some heavy lobbying and the influence peddling must be INTENSE. Frontenac Ventures is a FRONT.

Additionally, I have a lot of information about earthquakes coming in Abbotsford, BC shortly. There will be traditional lands affected by those two. Martial law may be declared in my opinion; it's all a big fat SETUP. This neocon government will stop at nothing to put all activists behind bars and SHUT UP.

Please send SMOKE to everyone on traditional lands (and in our dingy government apartments, too) here in Canada.

The head of the OPP here in Ontario, Julian Fantino, is slated to be the new head of the RCMP when the Vancouver Olympics are held. This is his "testing ground" I assure you all. He regularly surveils my blog(s) from a location in Barrie. So ... please, get on with the support before he takes me DOWN. So, far he hasn't managed it due to the fact Google uses me as an intelligence source, seriously!! But they never ever index my Ardoch Lake OR Caledonia articles that I see.

I am SO busy, I don't even have time to write proper articles on this, so bear with me. I have gone all out to get GLOBAL ATTENTION FOCUSSED on what is happening here. If there is someone shot today this will be just like OKA very shortly.

Here is a link to ALL government MPs in Canada
http://www.yayacanada.com/MPs.html

Here is a link to ALL MPPs in Ontario
http://canadaonline.about.com/gi/dynamic/offsite.htm?zi=1/XJ&sdn=canadaonline&cdn=newsissues&tm=8&f=10&tt=2&bt=1&bts=1&zu=http%3A//192.75.172.22/web/members/members_current.do%3Flocale%3Den

Time is of the essence, friends. Just FLOOD ONTARIO and Canadian government officials. I'll be back when that Abbotsford thang starts happening and repost these links

Here is the email address to get updates.
davidrmaracle@...

We had a transit strike here in Toronto. I made MANY MANY calls to get good information - this is the one that RESPONDED. (hint, hint)


Hers is one other place to direct calls: DEMAND THAT THE REAL NEWS here in Toronto gets a camera crew to Ardoch Lake NOW. Put this out over the drum circle as fast as you can!

The Real News, (416) 916 5202.

As I said, expect McGuinty to go OFF LINE and to stop taking phone calls today!!

Your friend and SISTER,
Virginia
Many Rivers


I just called directly to the front lines and YES! they are all staring at SWAT and OPP cars sitting just on the edge of the Culbertson land claim area. They are wanting to REMOVE the road bloc protestors and perhaps the quarry protestors too. PRAY PEOPLE and forward this out EVERYWHERE
Bluejay
>
> **URGENT** Tyendinaga 9:30 am Monday morning, April 28th

>
> We have just been informed by the Tyendinaga Mohawk community
> spokespeople that SWAT teams are amassing right now on the Deseronto
> and Slash Roads, bordering the Tyendinaga quarry reclamation site.
> Community spokesperson Jason Maracle has just been told by the OPP to
> pull people out of the quarry because they are going in.
>
>
> please cal the premier's office immediately and urge them to:
>
> -Honour Mohawk land, call off the OPP: Do not risk people's lives
> for a gravel pit the government has already acknowledged is on Mohawk
> land!
>
> -Release all First Nations political prisoners! If they don't well will be seeing plenty more in the next few weeks here in Canada!!
>
> Premier Dalton McGuinty: 416-325-1941 (phone) 416-325-3745
> daltonmcguinty@....ca


I just called directly to the front lines and YES! they are all staring at SWAT and OPP cars sitting just on the edge of the Culbertson land claim area. They are wanting to REMOVE the road bloc protestors and perhaps the quarry protestors too. PRAY PEOPLE and forward this out EVERY!WHERE
Bluejay
>
> **URGENT** Tyendinaga 9:30 am Monday morning, April 28th
>
> We have just been informed by the Tyendinaga Mohawk community
> spokespeople that SWAT teams are amassing right now on the Deseronto
> and Slash Roads, bordering the Tyendinaga quarry reclamation site.
> Community spokesperson Jason Maracle has just been told by the OPP to
> pull people out of the quarry because they are going in.
>
>
> please call the premier's office immediately and urge them to:

>
> -Honour Mohawk land, call off the OPP: Do not risk people's lives
> for a gravel pit the government has already acknowledged is on Mohawk
land!

>
> -Release all First Nations political prisoners!
>
> Premier Dalton McGuinty: 416-325-1941 (phone) 416-325-3745
> daltonmcguinty@....ca


What happened - How you can help -Tyendinaga

Update: Sunday, April 27, 2008 – Needs of

Mohawks - Contacts of cops and politicians

MNN. Apr. 27, 2008. An email came from the real estate

agents, Emile and Theodore Nibourg,

enibourg@sutton.com.


These are the guys who wanted

to build condos on Mohawk land, or at least they wanted

to make it look like they were building condos. They

knew the Mohawks would object. They even told some

of us they were hoping to get a pay out guaranteeing

their profits from Canadian taxpayers when the deal fell

through. What a scam! The "OPP" [who help the thieves

of "Other Peoples Property"] fell for it hook, line and

sinker. These are Nibourg's puppets. You can

practically see the strings. In a press statement Nibourg

said, "We sent out a media release last week stating we

are refraining from continuing our plans to develop the

land to allow for a peaceful resolution and negotiations

with the government".

We want peace too. There is nothing to resolve. If

someone was trespassing on your land, what would

you expect the police to do? Kick them off or kick you

off? Why are the police on Mohawk land? They were

not invited, Nibourg's gone, the cops are trespassing!

They are also violating international law by unlawfully

confining our people.

Throughout the Rotiskenekete have not blocked any

roads. Commissioner of the OPP, Julian Fantino, said,

"There are no blockages except for the ones we put up.

It's all peaceful now." Even though the Globe and Mail

has published photos of the cops pointing guns at us

and beating up our people, Fantino tried to deny this

happened in a Canadian Press release, of April 26th.

He said, "There are claims on blogs that police officers

pointed their guns at unarmed women and children,

broke people's arms and beat prisoners". Fantino went

on to say, "I think it's inflaming what is already a very

tenuous, very difficult situation".

Fantino didn't denying any of this. There's obviously

a double standards in Canadian society. A photo of

an ordinary person resisting violence results in

immediate charges and an arraignment in court. A

photo of a cop doing the same things results in

excuses, foot shuffling and obfuscation. It looks like

becoming a cop makes them immune from prosecution.

It's becoming a magnet for thugs. Fantino doesn't like

it when the brutality and law breaking of his henchmen

gets publicized. [MNN has photos of cops standing

behind their patrol cars, pointing their weapons at us.

Also, in the Globe and Mail is a photo of the cops

beating one of our men in the ditch and breaking his

arms.]

Fantino told the Globe Mail, "The hard work and

dedication of our officers in protecting the citizens of

this community cannot go unnoticed". No kidding!


We have you on video beating up our people.


"Those

responsible for criminal activities will be held

accountable". If this is true, we expect to see some

cops wearing handcuffs in court prisoner's dock.

The standoff at the quarry continues. OPP are still

holding their positions, though their numbers have

decreased. Talks are ongoing between Tyendinaga

Mohawks and the OPP.

Today the OPP sent a message to the Rotiskenekete

at the quarry on Mohawk land. "Let's agree to walk

away from this and go our separate ways and then

nothing will happen"!!! Remember what happened the

other day when the OPP were arresting Shawn Brant

for a fake charge? They said the same thing. When

our five men got into their cars, ten OPP goons jumped

them, threw them in the ditch and beat them up. They

broke both arms of one native man and one arm of

another. Then the OPP put out a lie that one of our men

had a gun.

The Rotiskenekete listened and told the officer, "Put

out a statement that our men did not have guns and

that you lied, and then maybe we'll talk to you".

The community is still holding strong both inside the

quarry and outside on nearby Slash Road. There are

a significant number of supporters. People from other

Indigenous communities arrived last night and today.

Visits from allies are welcome. Come during daylight

hours. The situation is less tense at this moment, but

dynamics can shift suddenly.


Urgently Needed are – first aid - water - money -

non-perishable foods – meat – fish - camping

equipment – communications equipment – fuel – gas –

propane – mobile phones – phone cards – rain coats –

towels – soap – wet wipes – tooth brushes – tooth

paste – gloves – work shoes – boots – runners –

socks – mosquito repellant – sun block – radios –

two-way radios – hand held radios/scanners – cooking

utensils – plates – silverware – buckets – pails –

blankets and sleeping bags - and anything else you

can think of. Once again, the police have turned what

should have been a non-event into a summer project.


Directions to the site: take TransCanada Highway 401

to the "Marysville/Deseronto" exit (east of Belleville).

This is the exit to Highway 49. Go south [right] on

highway 49 for about 10-15 minutes. You'll pass a stop

sign "Tyendinaga". Once you hit the Slash Road, turn

left. Drive until you see the people and a big bonfire.

Tyendinaga_support@masses.tao.ca.

The five arrested on false charges of assaulting OPP

on Deseronto Road, are Matthew James KUNKEL, 21,

Clint BRANT, 29, Daniel John DORENE, 34, and Steve

CHARTRAND, 32. All four men are from the

Tyendinaga Mohawk Territory. They are scheduled to

appear on Monday, April 28, 2008 in Napanee court.

The names, ages and places of residence of the ten

trespassing police officers who committed the assault

on our men are unknown. Shawn BRANT, 44 years,

was remanded into custody and is also scheduled to

appear in Napanee court on Monday, April 28, 2008.

[Contact: Sgt. Kristine Rae, (613) 285-5479cell,

1-800-279-8660 pager].

Some have been released but we don't know their

conditions.

We demand our native men be released from the

colonial jails immediately. Here are some of the

colonial culprits.

Julian Fantino, is the Commission of the Ontario

Provincial Police, julian.fantino@jus.gov.on.ca,

julian.fantino@ontario.ca;

Governor General Michaelle Jean info@gg.ca;

Hon. Stephen Harper, Prime Minister of Canada

harper.s@parl.gc.ca;

Ontario Premier Dalton McGuinty

dalton.mcguinty@premier.gov.on.ca;

Paul Leblanc of Indian Affairs,

leblanc.p@ainc-inac.gc.ca;

Yvan Dery, Privy Council Office,

ydery@pco-bcp.gc.ca;

Sylvia McKenzie, Justice Canada,

sylvia.mackenzie@sppcc-psepc.gc.ca;

Gilles Rochon, Aboriginal Policing,

gilles.rochon@psepc.gc.ca 613-990-2666;

Emanuel Chabot, Public Affairs 7 Emergency

Preparedness

emmanuel.chabot@psepc-sppcc.gc.ca

613-990-4353;

Louis-Alexandre Guay, the inaptly named

"Justice Canada" lguay@justice.gc.ca;

Phil Fontaine, Assembly of [Colonized] First

Nations, reception@afn.ca;

Jim Potts, advisor to the inept Ontario

Provincial Police on Indigenous policing

who claims to be Indigenous 613-795-3907;

RCMP Royal Canadian Mounted Police,

London Ontario Detachment 519-640-7267;

Chuck Strahl, Minister of Indian Affairs,

819-997-0002, 819-953-1160, 613-992-2940

Fax 613-944-9376 strahc@parl.gc.ca;

Walter Walling, who organizes police

attacks against Mohawks such as the Jan.

12, 2004 debacle at Kanehsatake,

wallingw@ainc-inac.gc.ca;

Leona Dombrowsky, Member of Ontario

Legislature, 613-962-1144, 1-877-536-6248

Fax 613-969-6381

ldombrowsky.mpp.co@liberal.ola.org;

Michael Bryant, Minister of Aboriginal Affairs,

Ontario, 416-314-8693, Fax 416-314-2701,

mbryant.mpp.co@liberal.ola.org,

416-656-0943, 416-325-7754, Fax

416-325-7755;

L.G. Beechey Chief Supt. Commander

Eastern Region OPP, 613-284-4500

TO VERIFY AND FOR INFORMATION CALL:

Akwesasne Rotiskenekete 518-358-3660

Tyendinaga Aserakowa [Warchief]:

613-243-4993

Jan Hill [Longhouse] 613-961-8515

613-827-1547

Dan 613-919-1354

Rotiskenekete 613-849-1314 613-827-4991

613-577-1355


Activism! Stop FULL SPECTRUM DOMINANCE

The space program and the military industrial complex
The video, Arsenal of Hypocrisy

http://www.youtube.com/watch?v=TILB9DaMRt4
Part 1

http://www.youtube.com/watch?v=_DNxhVBfvyI&feature=related

Part 2

War from Space

Voices of the global Network
World peace forum
Vancouver, Canada June 2006

Background articles on Ardoch Lake, stop uranium mining in Ontario!!

http://www.minesandcommunities.org/article.php?a=729

Canada Uranium update

3rd August 2007

As Cameco faces an image problem, associated with its uranium mining in the Canadian provinces of Saskatchewan and Ontario, another uranium mining company, Frontenac Ventures, is facing opposition to the opening of its mine from the Algonquin First Nations. The Algonquins are "asserting their aboriginal rights in the name of the collective good, the preservation of the land against what they perceive as a dire threat of contamination through uranium exploration and mining." Amending legislation to combine surface and subsurface property rights in Eastern Ontario was recently supported by representatives of all political parties in the area where Frontenac is prospecting.


Cameco's image takes a beating

By Randy Burton, The StarPhoenix

2nd August 2007

Under normal circumstances, these would be the best of times for Cameco Corp.

The uranium giant is just coming off the most profitable quarter in its history, with earnings of $205 million on record revenues of $725 million.

It has been selling uranium at rates that are 61 per cent higher than a year ago and sales volumes have doubled. For 2007, revenue is expected to be up by a whopping 40 per cent over 2006.

All of this tends to blunt the complaints in the stock market that Cameco has been too complacent in an era of unprecedented prices for uranium and a wave of consolidation in the industry.

It should also help to ease concerns about the future of the company as one piece of bad news follows another.

In many ways, the past year can only be described as Cameco's annus horribilis. First it was the flooding at the company's Cigar Lake mine, caused by the failure of sealing metal doors and a shortage of underground pumps.

Then it was revealed that it will take at least a year longer than anticipated to bring the mine back into production. The latest blow to the company's profile came with the abrupt suspension of operations at its Port Hope, Ont., conversion facility following the discovery of soil contaminated with uranium.

The combination of these events has been driving down the price of the company's stock in spite of the balance sheet triumphs.

Cameco now finds itself characterized as "Sleepy Hollow" in the pages of the national Globe and Mail, where it is described as a staid sort of company where complacency is good enough.

Cameco's cautious approach to expansion makes an easy target in an era of rapid-fire deal making, but it ignores the fact that progress in uranium mining tends to be measured in decades rather than months. However, there's no doubt Cameco is operating in a climate of market hostility at the moment.

It was against this backdrop that Cameco president and CEO Jerry Grandey responded to the criticisms in discussing Cameco's financial results and operations with analysts and reporters this week.

While he acknowledges Cameco is suffering through some difficulties, Grandey argues the strength of the company's balance sheet is "a far better indication of the company's potential than recent news."

He also announced the company has launched a series of initiatives aimed at improving the company's oversight and accountability mechanisms.

"We understand that our operational performance must improve, from the top of the organization to the people on the front lines," he said.

Given the importance of Cameco to Saskatchewan, this is all good news. The question is whether it's enough for federal regulators.

Linda Keen, the tough, no-nonsense chief executive of the Canadian Nuclear Safety Commission (CNSC), has been less than pleased with Cameco's recent performance.

At a meeting with company officials in June, Keen made no bones about where she thinks responsibility lies for the string of setbacks the company has suffered of late.

She bluntly told Cameco officials that the CNSC has lost faith in the company following the flooding of the Cigar Lake mine.

"One of the very serious results of this is a lack of confidence that now the CNSC, the commission and the staff, has in Cameco and in the leadership of Cameco," she said.

Keen was having none of Grandey's argument that there were a number of root causes for the accident.

"Mr. Grandey, with due respect . . . I think there was a root cause of leadership and I think it's leadership that we all accept at the top of organizations for what happens in this," she said.

If you look at the situation from Keen's point of view, it's easy to understand her skepticism. After all, Cameco has also had flooding at its McArthur River mine back in 2003, and appears to have been extremely slow to learn the lessons of that disaster.

Keen also has pressures of her own to deal with. The CNSC has taken over from the old Atomic Energy Control Board (AECB), which she recently suggested was seen as being too close to industry. Thus, she is motivated to ensure the federal regulator is not only independent, but is seen to be independent.

Consequently, Keen is in no mood to cut Cameco any slack with regard to its responsibilities. In a recent speech to the Canadian Nuclear Association, she talked about licencees' need to understand that they also have a "social licence" to fulfil, "where a better understanding of their responsibility for transparency and clarity must be achieved with communities, public interest groups and citizens."

Cameco, of course, is a model corporate citizen within Saskatchewan, and Grandey himself has been more than generous in his contributions to community life.

But the confluence of problems on his watch has presented him with some serious challenges.

It's one thing to have back seat drivers in the investment community pick apart your decisions and whine about shareholder value. It's quite another when the head of the country's nuclear regulator suggests you're not doing your job.

After all, the company's future and the fate of thousands of jobs in the Saskatchewan uranium industry depend on satisfying the national licensing agency.

Cameco has clearly been put on notice that it has to do better.


Uranium drilling fight gets hot

Natives warn of threat to Ottawa's water as company looks to court to end blockade

Suzanne Ma, The Ottawa Citizen

30th July 2007

A month-long standoff between two Algonquin communities in Eastern Ontario and a uranium prospecting company will be moving from a make-shift blockade near Sharbot Lake to a Kingston courtroom today, after the Ardoch Lake and Shabot Obaadjiwan First Nations were served with a $75-million lawsuit last week.

In late June, the two communities had joined forces to prevent Frontenac Ventures from drilling for uranium core samples on disputed land. Since then, all have been embroiled in what has been, so far, a test of nerves. Each side has accused the other of using intimidation tactics. The Algonquins allege the big-ticket lawsuit is Frontenac's latest "stunt."

The company has staked more than 5,000 hectares and was about to start drilling when the Algonquins and their supporters blocked them from accessing the land. They set up a gated base camp near Sharbot Lake, about 50 kilometres north of Kingston, and put up signs and flags, parked a couple of trailers and pitched tents. A handful of people have remained on-site 24 hours a day since June 28, and a number of volunteers guard the perimeter of the staked land.

The Algonquins say the land belongs to them -- most Ardoch Lake and Shabot Obaadjiwan First Nations are non-status Indians, meaning they never signed a treaty to extinguish their land rights in exchange for reserves and services -- and they're upset the province didn't consult them before giving Frontenac Ventures permission to explore for uranium.

The Algonquins and their supporters say they're worried that exploration and mining will contaminate their lands and water with radioactive waste. The waterways, they point out, are connected to the Ottawa River and could affect the drinking water in the nation's capital.

Frontenac's lawyer, Neal Smitheman, said he will be seeking an injunction to have the blockade removed while working on getting Frontenac access to its mining claims, which were approved by the Ontario Ministry of Northern Development and Mines.

"If we don't get something resolved soon, it could put the company out of business," Mr. Smitheman said. "When you do things like this, when you occupy and prevent access to people from doing what they have a lawful right to do, they can have serious ramifications."

Paula Sherman, co-chief of the Ardoch Lake First Nations, said the lawsuit has only strengthened her people's resolve.

"We're not leaving until there's a moratorium on uranium mining," said Ms. Sherman, who has been living in a trailer at the base camp.

"We will never allow them to have entry. It's our land. We have a responsibility to take care of the land for future generations."

The apparent confusion over land ownership comes at a time when several Algonquin communities in Ontario are engaged in land-claim negotiations with the provincial government. Frontenac's staked land is just part of a vast territory in dispute, stretching from Algonquin Park all the way to the front lawn of Parliament Hill.

The Ardoch Lake and Shabot Obaadjiwan First Nations only recently discovered Frontenac Ventures was on the land when an area resident showed up at an Ardoch Lake council meeting a few months ago.

Frank Morrison, who owns 100 hectares of pristine streams, meadows and trees in North Frontenac, found out last November that his land had been prospected for uranium.

His story was featured in the Citizen earlier this month, where he described coming across scarred trees and stumps bearing metal tags with the Ontario trillium symbol. Mr. Morrison started doing some of his own digging, and found a 139-year-old piece of Ontario legislation that allowed mining prospectors "free entry" to his property. He also learned he didn't own the "mineral rights" to his land, so while he owned the surface of the land, he did not own what was buried beneath. And, he found out who the prospector was: Frontenac Ventures.

"Frank came in and said all of his land had been dug up," Ms. Sherman said.

"We began to check it out and discovered roads had been dug out and trees had been cleared."

Algonquin representatives confirmed with the ministry that a chunk of their land had indeed been staked by Frontenac Ventures. First came disbelief. Then anger. And, as word spread throughout the community, non-natives joined in the fight. This week, Dawn King drove to the base camp from near Perth, bringing food and supplies.

"It's a human issue. It's not a native issue. It will affect us all," said Ms. King after unloading a carload of donations from the community, including toilet paper, homemade salsa, bread, eggs and cheese.

Earl Recoskie, a 56-year-old retiree, moved to the area six months ago, drawn to North Frontenac's beautiful lakes and marshes. He wasn't happy when he found out Frontenac Ventures was planning to dig for uranium. He now visits the blockade every day.

"It's disastrous, as far as I'm concerned," he said, resting under the shade of a tent. "We find out a uranium mine could very well be in our backyard. For our sakes and the First Nations' sakes, we are going to do everything we can to try and stop it."

But while much frustration lies with Frontenac, Mr. Recoskie and Ms. King said they were disappointed with the province's inaction.

"You can say what you want about ... any business. They're going to try to do what they're going to do to make money. But the government has the responsibility to do what's right," Mr. Recoskie said.

That's one thing that the Algonquins and Frontenac Ventures can agree on: that the Ontario government granted permits to the company. They gave the go-ahead without saying a word; not a word to Frontenac about the potential conflicts they could face with the local Algonquins, and not a word to the Algonquins, who only learned of the drilling plans when Mr. Morrison tipped them off.

"We do have an obligation to consult First Nations," allowed Laura Blondeau, press secretary for Rick Bartolucci, minister of northern development and mines. But did the ministry consult the Ardoch Lake and Shabot Obaadjiwan First Nations before Frontenac moved in?

"I cannot confirm this," said Ms. Blondeau, who could only say that the ministry was continuing "to establish better processes" when dealing with such matters. Randy Cota, co-chief of the Ardoch Lake First Nations, said many people in the community are fed up.

"We're used to this, (First Nations) have been burned so many times," he said. "The government asks, 'Why can't you trust us?' When (throughout) all of our Canadian history, can you tell me one time when we ever got a fair shake?"

Mr. Smitheman said the public has been misinformed about Frontenac Ventures' plans. "Frontenac Ventures is really a prospector rather than a mining company," he said. "They are trying to gather samples to see if it's a feasible mining site. They want to drill some holes and get some samples. It's no different for someone to drill a hole for water in that area."

But Mr. Cota said there would be no drilling of any kind on the disputed land.

"It's our homeland, we have no place else in the world for the Algonquin people to call home," he said. "We have a responsibility to the land, to respect her and not abuse her. It's time for us to step up to the plate."


Candidates express broad agreement over mining issues

by Jeff Green, Frontenac News

26th July 2007

The Liberal, Conservative, and NDP candidates for the upcoming provincial election in the Lanark, Frontenac, Lennox and Addington riding, participated in a forum sponsored by the Bedford Mining Alert (BMA) on July 21 at the Bedford Hall.

The Green Party, which has yet to select a provincial candidate, sent their federal candidate, Chris Walker.

Prior to the meeting, the Bedford Mining Alert had provided each of the candidates with background information about issues related to prospecting on private lands, and the candidates answered a series of questions from BMA member Justin Connidis

The four candidates all agreed on a major issue that has been championed by the Bedford Mining Alert for years - they favoured the uniting of surface and subsurface rights, at least in Eastern Ontario.

Throughout Ontario, a small percentage of landowners do not own the subsurface rights to their property, and these properties are available for staking by prospectors. Prospectors are exempt from normal trespass laws in pursuing their interests on these lands, and they are allowed to clear brush, cut trees, and do trenching on the properties without the consent of the landowners.

Ian Wilson, the Liberal candidate, pointed to proposed legislation that has just been posted for review, legislation that would see changes to how the Mining Act is implemented in the future. (see "A way forward or half a loaf?") The changes do not include uniting surface and subsurface rights, however. Wilson was willing to go further, "I do support uniting surface and subsurface rights in Eastern Ontario," he said.

Although Randy Hillier said, "Surface and subsurface rights must be united", he also posed the issue against the context of the broader agenda of property rights, which he champions.

Chris Walker, from the Green Party, posed the issue in terms of sustainable growth, seeing the drive to extract resources as a symptom of an economy that is causing a host of environmental problems.

He also pointed out that he has researched the Conservative party policy on the Mining Act, and reported that he was told there are no plans to change the mining act.

"That could change," Randy Hiller responded.

"The key issue is not uniting surface and subsurface rights, which I do support" said Ross Sutherland from the NDP, "it is broader than that. There should also be more controls on exploration on Crown lands, and Natives need to be consulted when their lands are being affected."

Before the discussion concerning surface and sub-surface rights got underway, Frank Morrison and John Kittle made presentations. Frank Morrison told the kind of story that is familiar to Bedford Mining Alert members: that of finding his land disturbed and stakes in the ground, and through research realising that prospectors have extensive rights on his land.

In his case, however, it was not a graphite or wollastonite deposit that is being explored, as is common on Bedford. Morrison lives in North Frontenac Township, and the company that has staked his property is Frontenac Ventures Corporation.

John Kittle spoke specifically about uranium and the consequences of uranium mining and exploration.

The candidates were not asked directly about their response to the uranium exploration in North and Central Frontenac until the tail end of the meeting, when the public had their chance to ask questions.

Norm Guntensperger asked them if they support the activities of the Algonquin protesters who have occupied the site where Frontenac Ventures had been located.

Both Randy Hiller and Ian Wilson said they do not support the Algonquins, and Chris Walker and Ross Sutherland said they did.

However, all four candidates said they support a moratorium on uranium exploration in the case.

Although they oppose the occupation, both Ian Wilson and Randy Hiller said they did not favour a heavy-handed approach to the occupation by police or government officials.

"Confrontation does not serve anyone's interest," Wilson said.


Frontenac Ventures initiates lawsuits against Algonquins at mine site

by Jeff Green, Frontenac News

26th July 2007

Frontenac Ventures Corporation has initiated legal proceedings against the Shabot Obaadjiwaan First Nation, the Ardoch Algonquin First Nation, and the leadership of the two communities: Doreen Davis, Paula Sherman, Randy Cota, Bob Lovelace, and Harold Perry.

The Ardoch and Sharbot Lake communities have occupied the Robertsville mine for the past four weeks. Frontenac Ventures has leased space at the mine site as a base camp for exploring a 30,000-acre swath of land for uranium content in the hopes of finding an "economic deposit", in the words of company President George White.

Company lawyer Neil Smitheman said the lawsuit names the First Nations and their leadership because they have been blocking the company from pursuing its business interests. "We need to have this dealt with fast," Smitheman said. Frontenac Ventures is scheduled to complete a deal, described by Gorge White as a "reverse takeover" with Sylvio Ventures of Vancouver on July 31. The deal could lead to the company achieving a listing on the Toronto Stock Exchange later this year. There is no word on how the occupation of the Robertsville mine will affect these dealings.

The suit is scheduled to be heard in Kingston Court on July 30, at which time Frontenac Ventures will be seeking a court injunction to remove the Shabot Obaadjiwaan and Ardoch Algonquins from the Robertsville mine. The federal and provincial governments and the Ontario Provincial Police were served papers as well, although they were not named in the lawsuit.

"They were served," Smitheman said, "because they will be expected to act if there is a court injunction."

Smitheman said that the July 30 court date was the first available date in Kingston.

For their part, the Algonquin leadership refused to acknowledge the legal papers when they were served on Monday July 23.

In other news in this ongoing situation, Minister of Aboriginal Affairs David Ramsay said last week that he will not intervene in the matter, leaving it to the Ministry of Northern Development and Mines to deal with.

An anti-uranium information picket is planned for Saturday, July 28, in the Town of Perth along Highway 7. Cars will be slowed in both directions to allow for information to be passed, but the road will not be closed.


A way forward, or half a loaf?

by Jeff Green, Frontenac News

26th July 2007

As Bedford Mining Alert members grilled provincial politicians on the mining act in the Bedford hall last week, Peter Griesbach sat silently at the back of the room.

It's not that Peter Griesbach is indifferent to the mining act. Since 2002 he has been a member of the Minister's Mining Act Advisory Committee (MMAAC) and is chair of a subcommittee of MMAAC that has prepared an amendment to the mining act. The amendment has just been posted for comment on the government's Environmental Registry.

The amended act would not unite surface and subsurface rights, nor would it allow surface rights owners to purchase the subsurface rights to their property, but it would increase the amount of land that is exempt from staking, and would also require more and fuller notification to surface rights owners before a prospector can enter their property.

Peter Griesbach got involved in mining rights in the same way many other people do - he found that someone had entered his property and cut down trees. He phoned the OPP to report a trespass, and was eventually referred to the Ministry of Northern Development of Mines, who informed him that his property had been staked.

"I never thought that unifying surface and sub-surface was do-able, and it was never on the table as we worked through changes to the sections of the mining act that dealing with staking on private property," Griesbach said.

Although he has been chairing the subcommittee that prepared the proposed amendments to the act, he is the only member of the community that is not either a ministry employee or a representative of mining or prospecting interests.

"This has not been a problem," he said, "because everyone had an interest in establishing rules that would not lead to conflicts in the field. The clearer the rules, the easier it will be for everyone."

Among proposed changes that affect Southern Ontario is the elimination of the physical staking of claims. Claims will be staked through interment mapping, thus eliminating the first instance of potential conflict with landowners. The prospector staking a claim will then have 60 days to notify the surface rights owner. As well, 30 days' notification will be required before a prospector can enter the surface rights owner's property, and the specific work plans will have to be given.

It is also proposed that the prospecting company will be required to repair any damages to surface lands that is caused by their activities.

Lots that are one hectare or less will be exempt from staking, as will a one-hectare ring around a residence on lots that are larger than one hectare.

Certain other kinds of property will be exempt from staking as well, if the amendment goes through, including: subdivisions, residential and cottage lots, railway lands, cropping and other farm operations, municipal lands such as parks, etc., and managed woodlots.

The proposed changes are described at a link from

http://www.eco.on.ca/english/others/regpost.htm.


Get off my land

Editorial by Jeff Green, Frontenac News

26th July 2007

In a telling scene during Fiddler on the Roof, a Cossack Inspector who has taken a liking to Tevye the milkman, comes to tell him that on the following day he will be forced to leave his home, and his village.

As Tevye contemplates his own powerlessness in the face of government forces, he reacts in the only way he knows,

"Get off my land,"
he says, "
This is still my land, get off my land."

Peter Jorgensen, the part owner and manager of the Robertsville mine, might understand Tevye's reaction, as might Frank and Gloria Morrison, as do First Nations peoples throughout North America, as does George White of Frontenac Ventures Corporation.

Peter Jorgensen has been told that he faces arrest if he so much as approaches his property; Frank and Gloria Morrison have had their property altered by prospectors; First Nations peoples were herded into reserves or left to drift away from their traditional lands about 200 years ago; and George White cannot access property that he has leased or conduct exploration land on property that he has legally staked, again under threat of arrest.

What we have here is a conjunction of cases where the supposed rights of individuals are coming into conflict with the rights of the collective, and these conflicts are not easily resolved.

Peter Jorgensen is clearly on the losing end thus far. He cannot access a property that he holds a legal deed to.

The Algonquins who are preventing him from accessing the property are not doing so for financial gain. They are asserting their aboriginal rights in the name of the collective good, the preservation of the land against what they perceive as a dire threat of contamination through uranium exploration and mining.

Not only do they have nothing to gain financially from this, they are now facing a $77 million lawsuit for their trouble. But as altruistic as the Algonquins' goals may be, their assertion of collective rights impinge directly on Peter Jorgensen's individual rights.

Many members of the Frontenac and Lanark communities fear for their own well being, the well being of their land and their families, if a uranium mine is built. This fear is akin to the fear expressed by the Algonquins, who say that if the land is gone they are gone as a people.

The provincial government is perhaps more concerned that the lights will go out across the province if uranium mining is curtailed. So, whose interests are more important? Thousands of Eastern Ontarians and a tiny native community, or ten million people who expect the power to flow to their own houses?

The government has the right to expropriate the lands of private individuals for airports or roads, so why not for greenhouse-free power?

In the end we are all like Tevye, and Peter Jorgensen. We might own our land today, but that could change.


STRATCOM CONFERENCE TAKES ISSUE GLOBAL




Two hundred people from 12 countries and 28 states gathered April 11-13 at the Global Network Against Weapons and Nuclear Power in Space 16th Annual Space Organizing Conference to learn about this remote command in America’s heartland. And the local sponsor, Nebraskans for Peace, who for years had been fretting about what was going on in its own backyard, couldn’t have been more excited. There’d never before been an international conference specifically addressing the transformation that’s taken place at StratCom. But then, until just recently, StratCom had never before represented the threat to the world that it does now.


From the moment George W. Bush was rushed to StratCom’s underground headquarters at Offutt A.F.B. on 9/11, the U.S.’s nuclear command began to undergo what StratCom Commander General Kevin Chilton described as “not a sea-state change, but a tsunami of change” in its role and mission. In the years since 9/11, the command has seen its traditional and sole responsibility of maintaining America’s nuclear deterrent proliferate to include missions for space, cyberspace, intelligence/reconnaissance/surveillance, missile defense, full spectrum global strike, information operations and combating weapons of mass destruction.


In the blink of a strategic eye, the command has gone from being something that was ‘never supposed to be used’ (i.e. the doomsday machine) to ‘being used for everything.’ It’s gone from being putatively ‘defensive’ to overtly ‘offensive’ to become, in the words of Nebraska activists, “Dr. Strangelove on steroids.”


With now eight missions under its belt, StratCom’s fingerprints are seemingly everywhere. Though it’s almost never mentioned by name, you can hardly open a newspaper anymore without reading about one of its various machinations. Here’s a rundown:


* Now charged with actively waging the White House’s “War on Terror,” StratCom is authorized to attack any place on the planet in one hour—using either conventional or nuclear weapons—on the mere perception of a threat to America’s ‘national interests.’
* Through its National Security Agency “component command,” StratCom is regularly conducting the now-infamous ‘warrantless wiretaps’ on unsuspecting American citizens.
* The proposed “missile defense” bases in Poland and the Czech Republic that are reviving Cold War tensions with Russia are StratCom installations under StratCom’s command.
* Having conducted what it touts as “the first space war” with its “Shock and Awe” bombing campaign on Iraq, the command is now actively executing the Bush/Cheney Administration’s expressed goal of the weaponization and “domination” of space.
* StratCom’s recent shoot-down of a falling satellite using its Missile Defense system, just after the U.S. had repudiated a Russian proposal banning space weapons, demonstrated the anti-satellite capability of this allegedly ‘defensive’ program and is certain to jump-start an arms race in space.
* In actively promoting the development of new generations of nuclear weapons (the so-called ‘bunker-buster’ tactical nukes and the Reliable Replacement Warhead), StratCom is seeking to ensure America will wield offensive nuclear capability for the remainder of the 21st century.
* Under the White House’s “Unified Command Plan,” StratCom commands access to the hundreds of military bases around the globe and all four military service branches, while working hand-in-glove with the CIA, FBI, Homeland Security and the Department of Justice.
* Operating like some executive branch vigilante and scofflaw, StratCom is now poised to routinely violate international law with preemptive attacks and to usurp Congress’ constitutional authority to declare war under the “War Powers Act.”


StratCom, in the words of Commander Chilton, is today “the most responsive combatant command in the U.S. arsenal”—and the next war the White House gets us into (be it against Iran or geo-political rival like China) will be planned, launched and coordinated from StratCom. In fact, Chilton recently told Congress, he believes the name actually ought to be changed to “Global Command,” to better reflect the “global” nature of its new role and mission.


This is the “New StratCom” that Nebraskans for Peace has watched materialize before its eyes. This is the enhanced threat, which the world community has no notion of whatsoever, because the changes at StratCom have occurred with the speed and power of a “tsunami.” This is the global menace the Global Network sought to expose to the international public at its conference in Omaha this past month.


And while the media coverage of the conference was minimal, the word is neverthess starting to get out nationally and internationally. Most of the people in attendance were activists, organizers and academics from all across the country and around the world. Picking up on the comment that StratCom is now a global problem, Jackie Cabasso of the Western States Legal Foundation stressed that addressing it will in turn require a global response. Americans, she said, can no more be expected to halt this threat than we can expect Nebraskans to do it: “It’s going to take the efforts of the world community.”


That sort of international commitment was already strongly in evidence. While the speaker from Poland was prohibited from entering the U.S. by Homeland Security, Jan Tamas of the “No To Bases Initiative” in the Czech Republic tied the proposed Star Wars radar in his country directly to StratCom. From the title of his talk alone, “StratCom is the Main Threat to Peace in the Korean Peninsula,” Ko Young-Dae, the representative from Solidarity for Peace and Reunification in Korea (SPARK), made it clear that he understood the connection to the Omaha command center. British activist Lindis Percy of the Campaign for the Accountability of American Bases, who regularly contends with StratCom’s presence in her homeland, sized it up perfectly with the expression, “horrid StratCom.” Similar sentiments were expressed by the German, Swedish, Indian, Japanese, Filipino, Mauritian, Italian, Romanian and Canadian participants. In country after country, an understanding the StratCom menace is starting to take hold.


The final keynote of the conference was delivered by Bishop Emeritus Thomas Gumbleton, who back in the mid-‘80s had committed civil disobedience at Offutt A.F.B. when it was still the “Strategic Air Command.” Back then, all we had to fear—and it was plenty—was nuclear holocaust. Today, the Bishop said, because of our greed for wealth and power, we now have to fear StratCom’s nuclear prowess and much more.


That greed for ever-more wealth and power had been the message of the conference’s first speaker, national Indian activist and Winnebago Tribe of Nebraska member, Frank LaMere. The city of Omaha, LaMere noted, was named after the Indian Tribe of the same name that had inhabited this area for centuries and still has a reservation about an hour north of the city. The Omaha, he said, had a covenant with Mother Earth, that in return for the corn and buffalo she so generously provided them to live, they would in turn honor her by living in a good way. Never, LaMere said, when the Omaha deeded their lands to the U.S. government—without once going to war—had they ever imagined that an instrument of destruction like StratCom, capable of destroying the Earth multiple times over, would rest on their ancestral homeland, on that sacred ground.


The Omaha, he said, cannot stop what is happening today by themselves. Nor for that matter can the people of Nebraska, nor even the people of the United States. To stop what is happening at StratCom—indeed to save ourselves from our own greed and self-destruction—Americans will need, LaMere said, the help of all their relations around the world. So he was cheered, he said, to see all these relations from around the world here in Omaha, willing to help. That was good, he said. But we need to act fast. Time is getting short.

A five-minute introductory video about StratCom created by Global Network chairperson Dave Webb, who is also the Vice-Chair of Britain's Campaign for Nuclear Disarmament (CND), can be viewed by clicking on: http://www.youtube.com/watch?v=TkOeUHHV1eU

- Written by Tim Rinne (Coordinator of Nebraskans for Peace) and Bruce Gagnon (Coordinator of Global Network Against Weapons & Nuclear Power in Space)



http://www.space4peace.org

Bruce Gagnon is the Coordinator of the Global Network Against Weapons & Nuclear Power in Space.

Between 1983–1998 Bruce was the State Coordinator of the Florida Coalition for Peace & Justice.

He was the organizer of the Cancel Cassini Campaign (launched 72 pounds of plutonium into space in 1997) that was featured on the TV program 60 Minutes.


Bruce has been featured by artist Robert Shetterly in his collection of portraits and quotes entitled Americans Who Tell The Truth. In 2006 he was the recipient of the Dr. Benjamin Spock Peacemaker Award.


In 2003 Bruce co-produced a popular video entitled
Arsenal of Hypocrisy that spells out U.S. plans for space domination. His latest video, shot in 2006, is entitled The Necessity of the Conversion of the Military Industrial Complex.

In 1968 Bruce was Vice-chair of the Okaloosa County (Florida) Young Republican Club while working on the Nixon campaign for president.


Bruce is a Vietnam-era veteran and began his career by working for the United Farm Workers Union in Florida organizing fruit pickers.


Catherine Austin Fitts: What can anyone do? A lot!

Remarks by Catherine Austin Fitts Gold Anti-Trust Action Committee
Inc. Conference GATA Goes to Washington -- Anybody Seen Our Gold?

Hyatt Regency Crystal City Hotel, Arlington, Virginia Saturday,
April 19, 2008

I would like to thank our chairman, Bill Murphy, and our
secretary/treasurer, Chris Powell, for the opportunity to speak
with you and to be a part of the extraordinary journey and network
that GATA has become.

Thank you for coming and making "GATA Goes to Washington" and our
efforts to press for full disclosure of the U.S. gold stores a
success.

To accomplish our goals in a politically managed economy requires
a new integration of political and market skills. From the vantage
point of good old-fashioned politics, I want to talk about what we
can do.

For some time we have been experiencing an extraordinary centralization
of economic and political power. Economic power, political power
-- the two go hand in hand.

We have watched assets shifted out of governments and central banks
worldwide and moved into private hands at below-market prices --
or simply stolen -- while liabilities have been shifted back, often
for free. Governments are not so much being privatized as piratized.
At the heart of this piratization has been the transfer of gold
stores into private hands, as gold is one of the most critical
strategic assets that one must control to achieve political power
--whether in one place or on an entire planet.

After almost a decade GATA and our allies have proved our point:
The precious metals market is manipulated. Time and the steady
bankrupting of the federal government's credit have also proved
what we have long known -- that the bankers and private interests
who manipulate the precious metals markets are manipulating markets
and events broadly.

GATA's efforts have helped to protect the personal, family, and
business assets of its growing numbers around the world.

Being right and helping a growing network of financial and natural
resource leaders around the world are creating a tremendous foundation
from which to build.

Yet, no doubt in anticipation of April Fools Day, on March 31
Treasury Secretary Hank Paulson, former chairman of Goldman Sachs,
announced the Paulson Plan (http://www.solari.com/blog/?p=772) --
an extraordinary proposal to expand the Federal Reserve's power --
including consolidation of control of all U.S. payments systems,
enforcement powers with respect to anything that moves in the U.S.
financial sector, and full authority with the President's Working
Group on Financial Markets to politically and arbitrarily determine
the cost of capital of every player in the economy through
government-funded means.

This means that the so-called cartel can ensure that any company's
cost of capital -- presuming we even have access to capital -- is
many multiples of that of Goldman Sachs and JP Morgan Chase (that
is, themselves), without regard to fundamental economic productivity
and performance. On top of that, they can stick the bill for this
politicized state of affairs back on us, whether through taxation,
inflation, or regulation.

Ultimately, no real economy, no real civilization, can survive such
a drain. This is the heart of the financial mechanism I refer to
as "the Tapeworm." Increasing the powers of this financial parasite
is a direct attack on life itself -- not just on us but on future
generations as well.

In short, we grow stronger, but so does the cartel we attempt to
hold accountable.

So the question before us is: What can we do? In a politically
managed economy, and in the political fight unfolding before us,
how do we shift the course of events in our favor and in the service
of freedom and life?

In honor of Edwin Vieira's marvelous book on U.S. monetary history
discussed yesterday, "Pieces of Eight," let me suggest eight areas
of opportunity for your consideration in the hope that one or two
will inspire you to action appropriate to your unique situation.

First: Let's buy gold and silver.

Those of us who are here today have enjoyed the protection afforded
by the knowledge that gold and silver are money. Our assets have
been protected accordingly. Now the time has come to help those
around you -- family, friends, and colleagues -- to understand the
importance of shifting their assets out of the bubble economy and
back to the real economy, first and foremost to precious metals and
the companies that responsibly explore for, produce, and manage
them.

More and more people are concerned about what is happening in the
current economic and political environment. At the same time,
investing in precious metals is a big step for people who have never
done it, are not financially sophisticated, or are not used to
managing market volatility. We are the early adapters. We need to
reach out to those around us and help them move their assets to
higher ground in a manner that diversifies ownership and control
of precious metals stores.

Second: Let's shift the media.

I don't mean wasting time with corporately controlled media that
is paid to centralize. We can encourage those we know to shift to
the many wonderful alternatives that have become available, including
the Internet sites and newsletters that are represented and mentioned
at this conference.

Can you imagine what the likes of Rob Kirby at Kirby Analytics,
Bill Murphy at Le Metropole Cafe, James Turk with his Freemarket
Gold & Money Report, Bill King at The King Report, and the countless
other excellent sites and newsletters represented in the GATA
networks could do if they had 10,000 more subscribers, let alone
100,000 -- let alone a million? Why not? They have been right and
Fox News has been dead wrong.

Let's support the Web sites, newsletters, and radio shows that are
creating access to a growing audience. Let's think big about shifting
the readership and cash flows into the right media.

Third: Let's shift the brand.

One of the cartel's greatest weapons is its brand. We have seen
leading members of the New York Fed and other Federal Reserve banks
such as Goldman Sachs, JPMorganChase, Citigroup, and Bank of America
commit atrocities again and again. The rape of Russia, the International
Monetary Fund's economic warfare throughout Latin America and Asia,
Enron, the pump and dump of the dot.com market, trillions of dollars
missing from the U.S. Treasury, the fraudulent inducement of America
through the housing and consumer debt bubbles, and the manipulation
of the precious metals markets are just some of many financial
crimes that have been used to engineer centralization by these same
players. We hear the same names over and over again. And yet if you
talk to those around you, everyone is still inviting such executives
and employees to parties, welcoming them as sons- and daughters-in-law
and doing business with them and their investors.

Why are we banking with these people? Why are we trading with them?
Why are we treating them as if they were socially acceptable?

I think the time has come for some serious, good old-fashioned
shunning.

Fourth: Let's shift the money.

With a shift in media and brand, it is then time to shift our
associations, our bank deposits, our brokerage business, and our
investments as far away from these enterprises as possible.

Now this is when I am always told that we are only a few people,
and our assets do not amount to market clout.

I don't believe it. First of all, I have seen what excellent people
can do with a small amount of resources when it was shifted into
them. Look at what Bill Murphy and Chris Powell and the GATA team
have accomplished on a shoestring. Look at what James Turk has
accomplished with several hundred million at GoldMoney. Several
hundred million may sound like a lot, but not when compared to the
billions the cartel is draining from our deposits, brokerage accounts,
and pension funds as we speak.

Then think of what would happen if we left today, and in the butterfly
effect of the possible, GATA and all the responsible, capable
business represented here experienced a sizeable inflow of assets
as those assets left JPMorganChase, Goldman Sachs, and their ilk.

I can imagine such a profound financial shift. You can too. Let's
create an intention to see the shift of billions of capital out of
the cartel and into the businesses represented and networked in
this room.

Fifth: Let's think and prospect locally.

This action item is critical because, ultimately, all politics are
local. Local action is how we pull the cash flow rug out from under
the cartel.

Wherever you call home, all around you are pools of capital. Perhaps
your church, temple, or mosque has an endowment. Perhaps your
university and your community foundation have significant investment
capital. Your municipal and state entities have pension funds.

All of these entities are doing business and getting drained by the
same criminality.

Where we know people, where we are active, let's start to lobby for
shifting assets and investments onto solid ground and get the
criminals out of the fee flows. If you donate money to an institution,
make sure they are not sending that money back into the cartel.
Let's use what we have learned to protect the capital pools around
us, including the precious retirement savings of our neighbors and
fellow citizens.

Shifting capital at a local level is particularly important as the
credit crunch unfolds, increasing the cost of capital available to
small business, small farms, and municipalities relative to their
larger counterparts.

The piratization that has asset-stripped the U.S. government is
working its way toward state and local governments as the early
signs of municipal budget woes and bankruptcies increase.

"The stock-market guys say you have to reach a bottom before you
can recover, and that a bottom is often signaled by the collapse
of some big entity. Many people thought it was Bear Stearns Cos.
In reality, it's Jefferson County."

-- Joe Mysak of Bloomberg News Service, "Largest U.S. Municipal
Bankruptcy Looms in Alabama," April 11, 2008.

Perhaps it would be better if, instead of deploying our local capital
to finance large corporations, investment funds, and banks coming
in as speculators to buy up our local assets at depressed prices,
we buy them ourselves. Indeed, if we had our capital safely stored
in gold and silver instead of in the cartel, we would increase our
capacity to do so.

As assistant secretary of housing in the first Bush administration,
I was responsible for cleaning up the bust of the last housing
bubble. At one point my staff identified a town in New Mexico in
which 70 percent of the mortgages were in default and owned by the
Federal Housing Administration, Fannie Mae, and Freddie Mac. I asked
my staff why the community did not buy the mortgages. Taken aback,
they explained that the community had no money.

I explained that I was from Wall Street, where we regularly bought
things without money. We created an entity and used stock. Since
the town clearly needed to reinvent its local economy, why not
create an entity and swap stock for the FHA mortgages?

Securitization of real estate was still a novel idea in 1989. Today
there is no longer a reason for the local community to be outbid
by speculators if its financially sophisticated citizens take heed.

Today the question is still before us: Who will clean up the defaults
-- Wall Street or Main Street? I would suggest that the answer is
that the cleanup will be done by the players that we finance with
our capital.

Did you know that at the end of the Great Depression, America had
3,200 community currencies? There are numerous groups throughout
America interested in starting community currencies. As my good
friend Franklin Sanders likes to say, using precious metals could
be the "Just do it!" shortcut. (See www.SilverAndGoldAreMoney.com.)

Sixth: Let's think global too.

In every other industry of clear strategic importance -- food,
water, other natural resources, new technology -- the big guys are
trying to squeeze the little guys by manipulating their cost of
capital and using a variety of dirty tricks. Where can we network
with leadership in these other sectors who are struggling to best
the same cartel without the benefit of our knowledge of money and
financial markets? Where is the opportunity for us to ensure that
we are circulating our money and know how to each other and not
back to the cartel?

Seventh: Let's teach our young people about the importance of gold
and silver.

To win the younger generations, we need to undo some of the most
powerful brainwashing that the cartel has been selling.

First, we need to teach the younger generations that fiat currency
has done more damage to the environment and to human and animal
rights than the most irresponsible mining companies dared even dream
of doing.

Second, we need to challenge the definitions of socially responsible
investment that shun precious metals and natural resources and
instead channel retail capital to cartel stocks and bonds. Diversifying
the ownership and control of precious metal stores and the exploration,
production, and management capacity is arguably the most socially
responsible investment on Earth today.

Eighth: Let's support GATA.

All solutions start with truth. To grow our capital and thrive in
this environment, it is essential that we continue to illuminate
and document the mechanisms a politically managed market uses. We
need to switch the cartel's market force out of the magic of the
black box and black budget and into the daylight in a way that
returns market power to our team.

Can you recruit more members? Can you promote links to our site and
bring us more media attention? If you have not yet, can you donate
what is appropriate for you?

I can assure you that GATA appreciates your support and will go far
with what you give.

In summary, there are many opportunities for action. Let's shift
the media, let's shift the brand, let's shift the money, let's act
locally, let's network globally, let's win the hearts and minds of
the next generations -- and let's support GATA as we do so.

As you return to your home, think about which actions are most
energizing for you. And remember: Whatever the cartel does to try
to persuade you that things are hopeless when they are not, you
must not take to heart.

Hold instead in your heart the memory of the stuff of which we are
made. I leave you with the words of Winston Churchill:

We have not journeyed across the centuries, across the oceans,
across the mountains, across the prairies, because we are made of
sugar candy.
I also want to remind you that encouragement is available daily.
Simply log in and read Bill Murphybs latest Midas column at Le
Metropole Cafe and Chris Powell's acerbic commentary on the GATA
wire.

Ladies and gentlemen, thank you so much for gathering at "GATA Goes
to Washington." My prayers are for your safe journey home and for
your efforts to blossom and grow until we meet again.

----

Catherine Austin Fitts, a member of the Gold Anti-Trust Action
Committee's Board of Directors, is president of Solari Inc. in
Hickory Valley, Tennessee, former managing director of the Wall
Street investment bank Dillon, Read & Co., and former assistant
U.S. secretary of housing.

* * *

Help Keep GATA Going

GATA is a civil rights and educational organization based in the
United States and tax-exempt under the U.S. Internal Revenue Code.
Its e-mail dispatches are free, and you can subscribe at
http://www.gata.org/.

GATA is grateful for financial contributions, which are federally
tax-deductible in the United States.


Judicial Watch Calls on FEC to Investigate McCain Presidential Fundraising

So who's to know the truth about ANYTHING.

They're all lieing scumbags. Some are richer than others, but all are RICH. No one's upholding the good of the common people. On the other hand, The Play's getting richer and richer as we enter Act II, scene whatever, eh?

Who gets offed soon? The US royal court is having its problems!! Somebody's gotta have a poisoning or heart attack soon. Otherwise, the servants will be turning off their plug-in drug heart attack machine TVs and figure out what has REALLY been going on.

I still firmly believe that HiLIARy is going to end up with that tiara on her ruthless little head, NO MATTER WHAT. The unthinkable will lead us further down the apocolyptic path. No one, no one at all thought a WOMAN could be president in 1930. But just watch how clever she really is. She set up Spitzer; McCain was a Real Ass to think he could get away with this one. He was too old to be president anyway.

No way Hills was gonna let little Ms. McCain and her Cindy doll world remodel the White House. That's where HiLIARy intends to hold court once again. And you won't see her baking cookies while she is there either.

Obama is tiring on the campaign trail. HiLIARy will be all over him again like a dirty shirt.

Stay tuned.
Love,
Madame Defarge

Judicial Watch, the public interest group that investigates and prosecutes government corruption, announced today that it filed a formal complaint, dated April 22, 2008, with the Federal Election Commission (FEC) related to a fundraising luncheon held at London’s Spencer House to benefit Senator John McCain’s presidential campaign. The venue for the event was apparently donated to the campaign by foreign nationals, in violation of federal campaign finance laws.

“Recent news reports suggest that Sen. John McCain and John McCain for President may have accepted an in-kind contribution from foreign nationals Lord Rothschild OM GBE and the Hon. Nathaniel Rothschild of Great Britain in contravention of federal election laws,” Judicial Watch President Tom Fitton wrote in a complaint letter dated April 22, 2008. “On behalf of Judicial Watch and its supporters, I hereby request that the FEC investigate the matter.”

The McCain fundraiser was held on March 20, 2008 at London’s Spencer House, billed as “London’s most magnificent 18th century private palace.” The McCain campaign distributed an invitation indicating that the site for the luncheon had been provided “by kind permission of Lord Rothschild, OM GBE and the Hon. Nathaniel Rothschild,” who are both foreign nationals. In statements to the press, the McCain campaign referred to the luncheon as a “fundraiser.”

While it is, as yet, unclear how much money was raised during the luncheon, had the venue not been donated to the McCain campaign, the net profit from the event would have been significantly reduced. The donation of the venue, therefore, represents an illegal in-kind campaign contribution.

According to 2 U.S.C. § 441e, Contributions and donations by foreign nationals, it is illegal for any foreign national to “make a contribution or donation of money or other thing of value” to a Federal, State or Local election. (Judicial Watch filed a similar complaint on April 14, 2008, concerning a fundraiser by Elton John for Hillary Clinton’s campaign.)

“The Clinton campaign recently accepted an in-kind contribution in the form of a fundraising concert by Elton John. And now the McCain campaign has apparently run afoul of federal election laws with this foreign fundraiser. The FEC must treat these incidents seriously, and hold any campaign that accepts contributions from foreign nationals accountable. We cannot allow these presidential campaigns to play fast and loose with the law,” stated Judicial Watch President Tom Fitton.

http://www.judicialwatch.org/files/2007/0408FECComplaintMcCain.pdf


April 27, 2008

Don't let shock overpower overpower your intelligence and logic: Mark Yannone

Don't let shock overpower your intelligence and logic

by Mark Yannone


Here is a video that tries to convince the audience that an Act of Congress can alter the Constitution, including the Bill of Rights. It cannot. This is how the Constitution is altered. And this is the result of trying to alter the Constitution illegally. If you believe otherwise, you, citizen, are fired.

Watch as this popular documentary tries to convince the nation that we have lost Amendments 1, 4, 5, 6, 8, and 13 by congressional legislation or executive order. Likewise, this documentary tries to convince the audience that the Military Commissions Act stripped our right of habeas corpus from the Constitution. Nonsense. Congress has no power to change so much as a comma in the Constitution. We have lost nothing but our minds.

Washington, You're Fired!


Note: You do not have to sign any petitions or write any letters to your representatives. Every two years you have the right to remove 100 percent of the members of the House of Representatives and 33 percent of the Senators. The ballot is available to register your demand.

3 comments:

Anonymous said...

LOL MARK WAS THAT YOU?? at approximately 21:40 they put a brain on you and you started twinkling I think. Hahahaha.

Good for you, Mark. Good for you!

Fred Marshall said...

Technically, you are absolutely right. I suppose that is a good argument you can make when you're stopped at any one of the growing number of arbitrary checkpoints across the country, as they snatch you out of the car and taser you as they drag you to a patrol car and haul you downtown. By the time you get before a judge, the charges (bogus all) against you will be so overwhelming that you won't escape scot-free.

Obviously you have not had a run-in with the "law" lately. I have. So have thousands of others. Law enforcement and the courts play by the Patriot Act "rules," not by the Constitutional prohibitions. I heard one judge, in a Larry Becraft trial, clearly say he wouldn't allow the Constitution to be quoted in his courtroom. I was there and personally heard that.

Former Texas attorney Harmon Taylor resigned the bar after losing his case before the court of appeals on the Timothy McVeigh case, when they ruled that the Constitution "is not admissible evidence of law." The public was told the 30-day delay in McVeigh's execution was because they had found some misplaced FBI files they wanted McVeigh's lawyers to see, but that delay was caused by Harmon's jurisdictional challenge based on the Constitution's requirement that wrongful death is a matter over which the State has exclusive jurisdiction, when it occurs anywhere within the state other than federally-owned property. The Murrah "Federal" building was OWNED by Oklahoma City and only portions of it were LEASED to the feds.

If I have $100 but you have it locked in your safety deposit box and won't give me access to it, is it really mine?

Fred

said...

Public perception is worth its weight in gold. If the public is led to believe that "Ron Paul can't win," can he win? If the public is led to believe that there are "only three candidates," can Ron Paul win? If the public is led to believe that Congress voted away the Bill of Rights, do you expect the public to demand enforcement of the Bill of Rights?

But we are a nation of laws, not a nation of wishes or illusions painted by TV broadcasters and commentators. So, yes, Fred, in the hypothetical example you gave, the $100 is still yours, and if I won't surrender it then you have a right to take action to get it. My decision cannot change your entitlement.

If a judge or police officer misbehaves, he doesn't have any effect on the law. The law stands until legally changed. Americans should know this well, so that at every turn we will object loudly and boldly to illegal government behavior.

Mark's amazing list of videos!!


Mark Yannone for mayor (click for info)




Check the earthquakes link, Abbotsford BC is really about to go under

I still do not see any emergency information coming out in CANADA to warn people and prepare them!!



The image above shows you the tec plates explicitly invovled



Global view

Local view



http://www.emsc-csem.org/index.php?page=current&sub=detail&id=84799#

This will give you the best information available!!

EMSC - European-Mediterranean Seismological Centre

Region, VANCOUVER ISLAND, CANADA REGION. Date time, 2008-04-27 at 21:18:07.7 UTC. Location, 48.79 N ; 127.99 W. Depth, 10 km ...
www.emsc-csem.org/index.php?page=current&sub=detail&id=84799 - 54 minutes ago

EMSC - European-Mediterranean Seismological Centre

2008-04-27 21:18:07.7, 48.79, N, 127.99, W, 10, f, mb, 4.9, VANCOUVER ISLAND, CANADA REGION. 2008-04-27 19:47:59.6, 52.37, N, 169.63 ...
www.emsc-csem.org/

EMSC - European-Mediterranean Seismological Centre

Back in time. 2008-04-27 21:18:07.7, 48.79, N, 127.99, W, 10, f, mb, 4.9, VANCOUVER ISLAND, CANADA REGION, 2008-04-27 21:39 ...
www.emsc-csem.org/index.php?page=current&sub=filter&min_mag=4

EMSC - European-Mediterranean Seismological Centre

6 Apr 2008 ... Cameroon, Canada, Cape Verde, Cayman Islands, Central African Republic, Chad, Chile, China, Colombia, Comoros, Congo, Congo (Dem. Rep. ...
www.emsc-csem.org/index.php?page=rye&sub=loc&id=82856

EMSC - European-Mediterranean Seismological Centre

... Burundi, Cambodia, Cameroon, Canada, Cape Verde, Cayman Islands, Central African Republic, Chad, Chile, China, Colombia, Comoros, Congo, Congo (Dem. ...
www.emsc-csem.org/index.php?lang=en&page=rye&sub=loc&id=84225

My warning appeared two weeks ago.


I asked someone in Canadian Action Party to go out and work to set up food bank locations IMMEDIATELY and work with the people in the solar companies to get funds.

Shit, this is happening very fast now.
http://www.opednews.com/articles/opedne_ladybroa_080414_martial_law_21_earthqu.htm
http://ladybroadoak.blogspot.com/search?q=Oregon+earthquakes

With Harper in POWER, this could get very very ugly very very fast. The corruption will be awful, just as it was after Katrina.

This has many many links to help you find out information when it develops.

It also has links about how FEMA will control the operation; thus Homeland Security clampdown on Canada is imminent.

click within the boxes for regional information
Map of recent earthquakes/blasts in Canada
Western Canada Eastern Canada Canada's Arctic
legend
List plotted pointsLarger image

Canada

In Canada...

Dozens injured as floor collapses at Christian rock concert in Abbotsford

Glenda Luymes and Erik Rolfsen, Canwest News Service

Published: Saturday, April 26, 2008

Stage scaffolding fell and knocked approximately 70 people through the floor and into the basement at a crowded Christian rock concert in an Abbotsford, B.C. church on Friday night.

Thirty-two people were injured and treated at Central Heights Church by ambulance, police and fire personnel from several Fraser Valley communities. Twenty-two of them had to be taken by ambulance to hospital, said Const. Casey Vinet of the Abbotsford Police. Three were seriously injured, although Vinet did not know their ages or conditions.

A group of teens embrace each other in the parking lot after the floor collapsed during a Christian rock concert, injuring at least 32 people at Central Heights Church on McCallum Road in Abbotsford on Friday night. (Ric Ernst - The Province)

A group of teens embrace each other in the parking lot after the floor collapsed during a Christian rock concert, injuring at least 32 people at Central Heights Church on McCallum Road in Abbotsford on Friday night. (Ric Ernst - The Province)

"This was a rock concert and it was attended mostly by youth," Vinet said.

About 1,000 people from around the Lower Mainland and Washington were enjoying the concert by Christian rock band Starfield when light fixtures and scaffolding above the stage crashed down at 9:17 p.m. It landed on a crowd of people dancing in front of the stage and knocked them approximately 12-15 feet through the floor to the basement below.

Alyx Peckinpaugh, 13, was distraught and crying after narrowly averting the fall.

"People were jumping and I started to jump," she said. She then saw a security guard gesturing and all of a sudden the floor gave way. "I ran to the wall and yelled for my friend. I couldn't find her, and then I saw her. I ran out to the hallway and then outside."

Groups of people, including parents of youth who attended the show, huddled outside the church crying and praying after the incident, as the injured were treated and rushed to hospitals in Abbotsford, Chilliwack and Langley.

"Most of the injured were walking wounded, but some were taken away in stretchers," said Chris Douglas, senior pastor of Central Heights Church.

Ryan Collum and Troy Grenier were at the chaotic scene trying to locate a friend who had been inside.

"We had a friend at the concert," Collum said. "We're really worried about her. We don't know where she is."

Lorin Bergen, pastor of Living Hope Church in Surrey, said four youths from his church were in hospital, one with a suspected broken arm and another with a gouged hand.

"We're just very thankful," Bergen said. "It could have been so much worse."

The concert wasn't organized by the church, said Douglas. Rather, the band's management had rented it out and sold their own tickets. Members of Starfield were aboard their tour bus outside but did not have any comment.

Vinet said the police's forensic identification team was going over the scene.

"Everything that can be done will be done to determine the cause," he said.

After the incident, first-hand accounts began appearing on Starfield's Facebook page. The following was posted by "Elwin" to the "Fan Wall" message board:

We were in the last row of the pews the crashed to the basement. We have bruising and lots of aches. Our pew landed on top of others with people underneath. Pray for them all.

"Walter" posted this:

I was there. Fortunately, my young sons and I arrived late and were in the balcony.

I pray for the band. I pray that they are not too shaken by the event. That those who were injured (and their parents) will heal quickly, and will not launch lawsuits against the band or the church. I pray for the congregation of Central Heights that they will be able to worship on Sunday and not be disrupted during the reconstruction.

When I went down to help with the trussing (I'm a former volunteer roadie) I saw that there was one woman who had fallen. She was lying face down, just to (audience) right of centre stage. She was unconscious and convulsing. I called 911 but couldn't get a line. This was at 9:18. I checked back after we realized that the horizontal lighting truss wasn't going to fall into the hole. She was lying on her back. I couldn't tell if she was OK or not. If anyone knows who she was or her condition, please update.

Guys from Starfield. I want to encourage you through what could be a tragedy. The guys from Shane and Shane talked about fires but that God was with Shadrack, Meshack, and Abednego. He will be with you through this. He will be with those who were injured as well.

Vancouver Province

Hey, you are on your own (YOYO) . why is the media and the government STILL so silent on this.

Look at the way this article twists what is going on in the Globe and Mail.

Chinese maker of the earthquake moving equipment

TRADEX
Abbotsford, B.C.

For more information about access to Tradex, please visit www.fxtradex.com or call 604.850.1533.

Another prospective big winner in the earthquake coverup sweepstakes to come. Wonder who they gave money to in the Canadian elections?

McElhanney Completes Clean Sweep of 2007 Transportation Awards

At the 2007 Consulting Engineers of BC Annual Awards on March 3rd, McElhanney received the Award of Excellence for design of the Mount Lehman Interchange, on the Trans-Canada Highway in Abbotsford. This was the top award out of 11 high quality submissions in the Transportation Category.


Coming less than a month after our two wins at the Ministry of Transportation Awards in February, this means that McElhanney has won all the first places in transportation design and construction in BC in 2007. This is an outstanding achievement that sets the bar as high as it can go.

Congratulations to Gary Tencha and Rob Parkinson who came up with the innovative design concept, and to the entire design team:

Gary Tencha, Project Director; Rob Parkinson, Project Manager; Dave Porterfield, Resident Engineer; Manfred Milewski, Resident Inspector; Dennis Karpluk, Bridge Inspector; Grant Stewart, Designer; Harold Smith, CADD; Jose Pinto, Traffic Engineering; Denny Leung, Signing Design; Jim Dumont, Drainage Design; Kent LaRose, Bridge Design; Parm Nahal, Quality Control; Ed Ho, Municipal Utilities Design

Read the Executive Summary of this submission


Recent Canadian earthquake news. Be sure to hit the links if you access this article. This is NOT business as usual.



Fault lines may threaten Victoria, Abbotsford
Globe and Mail, Canada - Apr 26, 2008
Two newly discovered earthquake fault lines running just south of the BC-Washington State border have the potential to inflict significant damage to the ...
Abbotsford at risk for earthquake Abbotsford Times
Updated maps show earthquake fault lines run into BC CTV British Columbia
all 4 news articles »
Seismologists warn shallow fault line near Abbotsford could cause ...
Canada.com, Canada - Apr 23, 2008
By Susan Lazaruk, The Province US seismologists warn a shallow fault line near Abbotsford could cause an earthquake the size of a 2001 temblor that caused ...

CTV.ca
US scientists find quake fault near BC town
CTV.ca, Canada - Apr 24, 2008
American scientists have found three new earthquake faults that may pose a danger to Canada's west coast. Despite the discovery, Abbotsford, which is about ...
School safety their priority, upgrades taking too long
The Province, Canada - Apr 24, 2008
But the busy Abbotsford mother of two was shaken to hear her city is sitting on a fault line. "That's kind of scary," she said yesterday while waiting to ...
Earthquake risk on North Olympic Peninsula detailed by scientists
Peninsula Daily, WA - Apr 24, 2008
The main danger is to Abbotsford, British Columbia, a city of about 175000, said Craig Weaver, the Pacific Northwest earthquake coordinator for the USGS. ...

KOMO
Scientists find two new earthquake faults in Western Washington
KOMO, WA - Apr 23, 2008
Weaver says a quake on that fault line could severely affect Abbotsford, British Columbia. Scientists are equal opportunity surprisers. ...
AMERICAS NEWS AT 0500 GMT
PR-Inside.com (Pressemitteilung), Austria - 17 hours ago
ABBOTSFORD, British Columbia _ The floor of a church filled with a mostly teenage audience of about 1000 people collapses during a concert, ...

Earthquake danger may be greater than previously believed
TheNewsTribune.com, WA - Apr 22, 2008
The main danger is to Abbotsford, BC, a city of about 175000, said Craig Weaver, the Pacific Northwest earthquake coordinator for the USGS. ...

Abbotsford<http://www.theglobeandmail.com/servlet/story/LAC.20080426.BCEARTHQUAKE26/TPStory/National>
> Globe and Mail - Canada
> This could turn out to be a very big fault that is
> fundamental to the way
> earthquakes develop in this part of Washington and
> southwestern *British
> Columbia*. *...*
> See all stories on this
>
topic<http://news.google.com/news?hl=en&ncl=http://www.theglobeandmail.com/servlet/story/LAC.20080426.BCEARTHQUAKE26/TPStory/National>
>
> *Earthquake* risk on North Olympic Peninsula
> detailed by
>
scientists<http://www.peninsuladailynews.com/article/20080424/NEWS/804240308>
> Peninsula Daily - Port Angeles,WA,USA
> The main danger is to Abbotsford, *British
> Columbia*, a city of about
> 175000, said Craig Weaver, the Pacific Northwest
> *earthquake* coordinator
> for the USGS. *...*
> See all stories on this
>
topic<http://news.google.com/news?hl=en&ncl=http://www.peninsuladailynews.com/article/20080424/NEWS/804240308>
>
> AMERICAS NEWS AT 0500
>
GMT<http://www.pr-inside.com/americas-news-at-0500-gmt-r558992.htm>
> PR-Inside.com (Pressemitteilung) - Wien,Austria
> ABBOTSFORD, *British Columbia* _ The floor of a
> church filled with a mostly
> teenage audience of about 1000 people collapses
> during a concert, *...*
> See all stories on this
>
topic<http://news.google.com/news?hl=en&ncl=http://www.pr-inside.com/americas-news-at-0500-gmt-r558992.htm>
>
> Google Blogs Alert for: *British Columbia
> earthquake*
>
> Are you *earthquake*
>
ready?<http://activerain.com/blogsview/486640/Are-you-earthquake-ready>
> By Raj Dhaliwal (MyAbbotsford.Com) (Landmark...(Raj
> Dhaliwal
> (MyAbbotsford.Com) (Landmark...)
> Two new *earthquake* fault zones have recently been
> discovered. One fault
> line is close, and could cause significant damage to
> Abbotsford *BC*. Newly
> released seismic hazard maps from the US Geological
> Survey feature the
> Boulder Creek Fault *...*
> Raj Dhaliwal - Abbotsford BC... -
> http://activerain.com/blogs/rajdhaliwal
> <http://activerain.com/blogs/rajdhaliwal>
>
> THE WEST SIDE USA / CANADA... 4-26-08 TO
>
4-30-08<http://journals.aol.com/nightangel7246/EARTHQUAKES/entries/2008/04/26/-the-west-side-u.s.a.--canada...-4-26-08-to-4-30-08/1182>


FROM PAM WISEMAN --

Big time pressure sympts for Off Vancouverdown to off N Calif- going into San FranciscoBay area and C Calif areas. Pressure all along this area nowWAtch for quakes in these areas-3's to 5.8+Apr 16 to APr 30
Off Vancouver to Off N Calif
4/16/2008 4:54pm

Earthquake risk on North Olympic Peninsula detailed by scientists - expect MARTIAL LAW

Earthquake risk on North Olympic Peninsula detailed by scientists


Click here to zoom...
Keith Thorpe/PDN




Peninsula Daily News news sources


PORT ANGELES — Government scientists are discussing two earthquake faults which could cause serious damage on the North Olympic Peninsula.

The U.S. Geological Survey released new seismic hazard maps this week that focused on quake faults across the nation, including the Lake Creek-Boundary Creek fault that runs from central to eastern Clallam County — from roughly 15 miles west of the Elwha River to just past Siebert Creek.

It is capable of producing a magnitude-6.79 earthquake and has been active over the past several thousand years.

It was studied in detail by scientists in 2006 and is included for the first time in the new seismic hazard maps.

A quake on this fault would be similar to the February 2001 Nisqually earthquake, which struck northeast of Olympia.

It had a magnitude-6.8 that caused more that $100 million in property damage and shifted the dome over the Legislative Building.

Subduction quake
Scientists also revised their estimates about the Cascadia Subduction Zone, where the Juan de Fuca and North America tectonic plates collide in an area off the coast between Vancouver Island and Northern California.

The northern part of the fault runs off the Olympic Peninsula coast.

New studies indicate the subduction zone is more likely to experience one great 9.0 quake that will completely rupture the fault, rather than the other possibility of a series of smaller, but still major, quakes in the 8.0 range.

Either way, subduction quakes could cause catastrophic tsunamis that would sweep over Neah Bay, LaPush and other coastal locations.

But earthquake experts say it takes about 500 years to build the pressure necessary for a 9.0 quake in the subduction zone.

Geological records suggest the last such quake was in 1700, meaning that the next big one could be 192 years away.

"Don't hold us to that," said Craig Weaver, the Pacific Northwest earthquake coordinator for the USGS. "But that is the math."

Using new models produced by the Japanese, Mark Petersen, chief of the USGS National Seismic Mapping Project in Golden, Colo., said a major subduction zone earthquake also could produce more ground motion than originally thought.

"This is very complicated, but the risks are slightly higher than before," he said.

Richter readings
On the Richter scale, every increase of one number means a tenfold increase in magnitude. Thus a reading of 7.5 reflects an earthquake 10 times stronger than one of 6.5.

An earthquake of 3 on the Richter scale can cause slight damage in a local area, 4 can cause moderate damage, 5 considerable damage, and 6 can be severe.

A 7 reading is a "major" quake, capable of widespread heavy damage, and 8 and above is a "great" quake, capable of tremendous damage.

The new seismic hazard maps also focus on the South Whidbey Island fault, which extends south of Whidbey Island.

Scientists say it is longer than previously thought, cutting through Seattle's heavily populated northern suburbs to Woodinville and perhaps as far as North Bend.

Weaver said this fault has the highest hazard of any fault in the state — and could produce a magnitude-7.5 earthquake.

He said there have been at least four quakes along this fault in the past 16,000 years.

"It cuts right through one of the most populated areas along Puget Sound," Weaver said.

Border fault
Another fault factored into the new maps is about 25 miles from Bellingham, not far from the Canadian border.

Known as the Boulder Creek fault, it is thought to be capable of producing a magnitude-6.8 earthquake and has been active over the past several thousand years.

The main danger is to Abbotsford, British Columbia, a city of about 175,000, said Craig Weaver, the Pacific Northwest earthquake coordinator for the USGS.

"It wouldn't have a lot of impact in Bellingham, but would have a lot of consequence for our friends in B.C.," Weaver said.

Quake hazards
The new National Seismic Hazard Maps — a series of maps and data sets that project the ground shaking that might happen at points throughout the country — shows much of the United States is on shaky ground, with 46 states facing serious seismic threats.

The new maps also provide further evidence of the high earthquake hazard in Washington state, among the highest in the nation.

Western Washington and Oregon are laced with 100 or so known faults, and no one is sure how many more crisscross the region.

More than 1,000 earthquakes occur in the state every year, including a magnitude-3.4 quake in Snohomish on Monday.

USGS last published nationwide hazard maps in 2002 and 1996.

The new maps are being released at the same time as a national revision of the model building codes used by state and local government so that buildings, bridges, highways and utilities can resist earthquake damage.

Insurance companies use the data to set rates in some places.

Engineers use the maps to forecast landslides and the stability of hillsides.

Federal environmental regulators use the maps to ensure waste-treatment facilities will hold up.

Emergency planners use the information to decide how to allocate money for education and preparedness.

Good news
The new maps also contain some good news for Washington residents.

Scientists now estimate that potential ground motion in the Western United States is 30 percent lower than they previously thought for the kind of quakes caused by long-period seismic waves that would affect taller, multistory buildings.

Scientists developed these new estimates by using new ground-motion predicting models created after looking at shaking records from 173 global shallow crustal earthquakes.

As part of a statewide earthquake drill Tuesday, Gov. Chris Gregoire urged Washingtonians to
prepare to be self-sufficient for at least three days following a disaster.


The USGS has prepared a pamphlet called "The Seven Steps to Earthquake Preparedness." Go to www.earthquakecountry.info and click on "Seven Steps" on the left.

The new seismic hazard maps can be seen at earthquake.usgs.gov/research/hazmaps/.

2-degree map

Click on an earthquake on the above map for more information.
click within the boxes for regional information
Map of recent earthquakes/blasts in Canada
Western Canada Eastern Canada Canada's Arctic
legend
List plotted pointsLarger image

Canada

In Canada...

4. 40 people injured when floor collapses at Canadian church
Filed at 10:47 p.m. ET ABBOTSFORD, British Columbia (AP) -- The floor of a church filled with...hole in the floor about 22 feet wide, said Casey Vinet of the Abbotsford police. Daase said minutes before the collapse, the band urged...
THE ASSOCIATED PRESS - Apr 26, 2008
www.nytimes.com/aponline/world/AP-Canada-Church-Accident.html?scp=1&amp;sq=Abbotsford&amp;st=nyt NYTimes

Taking a look at KOREA today ..

Ho hum.

Global problems everywhere, Dictators and corrupt regimes everywhere.

Let's have a look at another place DoKtor Riiiiiiiiiiiiiiiiiiiiice has her long fingernails into today, shall we?

Always watch what The Magician is doing with the other hand, they say.

I think that the NWO is quite fine with things in Iran. Israel may be allowed to indulge its suicide wish by nuking Syria at long last.

But that overstretched full spectrum dominanced US DoD, with that fanatasitic supermind Dick left unchecked by the fabu LOUSE ooooo Nancy PeLOUSy, well, let's just see what the powers that be can get up to in other parts of the world pie shall we?

If you hit the Korea link, you'll see it is just RIPE for destablization!! Yup, the US military is WAY overstretched in that part of the world and her allies are gonna head for the hills as the destructuring of the world's economy and market delivery systems get to be known.

Japan and Russia have a nice little energy pact; but Sakhalin is having problems. They could have a nuclear meltdown at any time due to the earthquakes and must be in a big fat snit. They'd like ot get their mitts on that natural gas pdq.

South Korea has a nice manufacturing base going, but IT needs oil. But that oil spill will take YEARS to clean up and drags down domestic morale. Twelve years are needed to clean up that spill!

Our Komrade in North Korea is losing his grip and has no food to feed his people!

The Korean war has NEVER BEEN OVER. The US is just a fool, naive bully in a highly technical age and BELIEVES it can bully everyone!! but hey! does anyone seriously believe that?

ONE MILLION CHINESE WERE LOST DURING THE KOREAN WAR!

Does anyone recall that historic FACT?

The cold war is back WITH A VENGEANCE, simmering outside the insane US/Canadian mainstream media, which doesn't want you or I to have any itty-bitty little idea what is going on.
Business as per usual. Nothing happening here, move along. They want you to believe that they are playing nice with Korea, but what is REALLY happening?


Rice says verifying N.Korea declaration to take time

Arshad Mohammed, Reuters Published: Thursday, April 17, 2008


WASHINGTON (Reuters) - U.S. Secretary of State Condoleezza Rice said on Thursday that verifying a North Korean nuclear declaration would take time and suggested some U.S. sanctions on Pyongyang may be dropped before it is complete.

But she also stressed that if the United States later found that North Korea had not been truthful in the declaration, there would be consequences for the secretive, communist state, which conducted a nuclear test in October 2006.

Separately, a senior U.S. official said an American team would visit North Korea next week to discuss how to verify the "complete and correct" accounting of its nuclear programs that Pyongyang was due to deliver by December 31.

North Korea's failure to produce the declaration has bogged down a 2005 multilateral deal under which the poor, isolated state committed to abandon all nuclear weapons and programs in exchange for diplomatic and economic incentives.

The declaration has been held up partly because of Pyongyang's reluctance to discuss any transfer of nuclear technology to other countries, notably Syria, as well as to account for its suspected pursuit of uranium enrichment.

Uranium enrichment could provide North Korea with a second way to produce fissile material for nuclear weapons in addition to its plutonium-based program, which it used to test an atomic device in October 2006.

Under the second phase of the six-party deal, once North Korea has produced its nuclear declaration, the United States is expected to relieve it of sanctions under the U.S. state sponsors of terrorism list and Trading With the Enemy Act.

But many other U.S. sanctions on North Korea will remain in place.

In the third phase, North Korea is expected to dismantle its nuclear facilities at Yongbyon and abandon all nuclear weapons in exchange for further economic and diplomatic benefits.

'NOT LOWERING THE BAR'

"Verification takes some time because these are complex programs, this is a nontransparent society, there is a history here of surprises and so it will take some time -- even past the second phase -- for verification to completely play out," Rice told reporters at a news conference.

"Whatever is done in phase two, if it's demonstrated in phase three that somehow something was wrong in phase two, of course, the United States reserves the right to take whatever steps it needs to."

A senior U.S. official who asked not to be identified said later that meant diplomatic or economic steps.

The Bush administration appears to have been stung by criticism from some conservatives that it might be prepared to accept a declaration that was less than comprehensive.

"We are not lowering the bar," said this official, who asked not to be named because of the sensitivity of the diplomacy with North Korea. "If they took any actions to deceive ... there would be consequences. There are many levers at our disposal, unilaterally or multilaterally."

The agreement to denuclearize the Korean Peninsula was reached among the two Koreas, China, Japan, Russia and the United States in the so-called six-party talks.

Clashes break out at Olympic torch relay in South Korea

Sunday April 27, 2008 2:31PM

SEOUL, South Korea (AP) -- Chinese students clashed with anti-Beijing demonstrators at the Olympic torch relay Sunday in Seoul, throwing rocks and punches at the latest stop on the flame's troubled round-the-world journey.

A North Korean defector tried to set himself on fire to halt the relay, where thousands of police guarded the flame from protesters blasting China's treatment of North Korean refugees.

But the small groups of anti-China demonstrators were far outnumbered by seas of red-clad Chinese supporters who waved red national flags as they took to the streets of the South Korean capital to defend the torch.

Police deployed 8,000 officers, some running beside the flame while others rode horses and bicycles with the relay through the city, which hosted the 1988 Summer Olympics.

China's crackdown on violent protests against Chinese rule in Tibet has triggered attempts to disrupt the torch run celebrating the August games at other stops of the torch relay.

In South Korea, many critics focused on Beijing's treatment of defectors who try to escape their lives of hardship in North Korea.

Thousands of North Koreans have fled across the loosely controlled Chinese border and many remain in hiding in China. If caught, they are deported by Chinese authorities and face likely imprisonment in life-threatening conditions back in the North.

The man who tried to immolate himself, 45-year-old Son Jong Hoon, had led an unsuccessful public campaign to save his brother from execution in the North, where he was accused of spying after the two met secretly in China. About an hour into the relay, Son poured gasoline on himself in the middle of a street, but police quickly surrounded him and carried him away before he could set himself on fire.

Two other demonstrators tried to storm the torch but failed to hinder its 15-mile trip from Olympic Park -- built in honor of the 1988 Summer Games -- to City Hall.

Police said five people, including a Chinese student, were arrested.

Scuffles broke out near the relay start between a group of 500 Chinese supporters and about 50 demonstrators criticizing Beijing who carried a banner that read: "Free North Korean refugees in China." The students threw stones and water bottles as some 2,500 police tried to keep the two sides apart.

One Chinese student swatted at the demonstrators with a flagpole. Another student was arrested for allegedly throwing rocks, said an official at a police station near Olympic Park. The official asked not to be named because the investigation was under way.

"The Olympics are not a political issue," said Sun Cheng, 22, a Chinese student studying the Korean language in Seoul. "I can't understand why the Korean activist groups are protesting human rights or other diplomatic issues."

Thousands of Chinese paced the torch on the 41/2-hour-long relay, some chanting, "Go China, go Olympics!"

Before the relay, two South Koreans who had been chosen to run said they would boycott it to protest China's actions in Tibet.

The torch arrived in Seoul from Japan, where Chinese supporters also outnumbered protesters who failed to disrupt the run.

After Seoul, the torch was scheduled to make its first-ever trip to North Korea for a relay Monday. Disruptions were not expected in the North, an authoritarian state that tolerates no dissent.

Copyright 2008 Associated Press. All rights reserved. This material may not be published, broadcast, rewritten, or redistributed.

Kim Jong-il builds ‘Thunderbirds’ runway for war in North Korea

An airbase inside a mountain is the latest sign that North Korea, whose links to Syria’s nuclear programme came to light last week, is cranking up its military machine

North Korean military engineers are completing an underground runway beneath a mountain that can protect fighter aircraft from attack until they take off at high speed through the mouth of a tunnel.

The 6,000ft runway is a few minutes’ flying time from the tense front line where the Korean People’s Army faces soldiers from the United States and South Korea.

The project was identified by an air force defector from North Korea and captured on a satellite image by Google Earth, according to reports in the South Korean press last week.

It is one of three underground fighter bases among an elaborate subterranean military infrastructure built to withstand a “shock and awe” assault in the first moments of a war, the defector said.

The runway, reminiscent of the Thunderbirds television series, highlights the strange and secretive nature of the regime that provided the expertise for a partially built nuclear reactor in Syria, film of which was released by the CIA last week.

The reactor was destroyed by Israeli aircraft last September in an operation that may have killed or injured North Koreans at the site in the remote deserts of eastern Syria.

The airstrike appears to have convinced North Korea to harden its own defences and to spend more on its military, even as it struggles to cope with a new food shortage that could see millions of its citizens go hungry. In recent days North Korea has ordered its people to be vigilant against “warmongers”.

“The prevailing situation requires the whole party and army and all the people to get fully prepared to go into action,” North Korea’s state media said on Friday.

Although the media unleashed a volley of abuse against the United States and Lee Myungbak, South Korea’s conservative new president, it also said “sincere and constructive” negotiations on nuclear disarmament were in progress, an apparent effort to play off hawks against doves in Washington.

Some diplomats, who are sceptical of the process, say that behind the rhetoric, Kim Jong-il, the North Korean leader, may sense that he is a hair’s breadth away from a deal that would leave him with up to 10 nuclear weapons and a security guarantee for his regime.

In Washington, nuclear experts were puzzled by the timing and quality of the evidence released by the Bush administration. Democrats suggested hardliners around Dick Cheney, the vice-president, had forced the issue to try to wreck the talks with Kim.

However, there is a more persuasive argument. Analysts in Seoul see the American disclosures as a sly way to keep the negotiations alive. Kim had refused to make a “full declaration” of his nuclear programme by a December 31 deadline; now, in effect, the CIA has done it for him. “The revelation was a highly orchestrated one,” commented The Korea Herald, adding that it “enabled” Pyongyang to “make its declaration without losing face”.

One indication is that Christopher Hill, the US State Department negotiator, flew to Singapore for an unusual session with his North Korean counterparts shortly before the United States went public. “There must have been some sort of secret agreement or deal,” said Taewoo Kim, of the Korea Institute for Defence Analyses in Seoul.

Last year Hill persuaded the White House that the talks offered a realistic chance to accomplish a peace treaty formally ending the 1950-3 Korean war, in which more than 50,000 Americans died. His critics, such as John Bolton, the former United Nations ambassador, say North Korea has a long recidivist history of selling missiles and unconventional weapons to unstable Middle Eastern regimes such as Syria, Iran and Libya.

Whatever the truth, even by the standards of North Korean politics the atomic intrigue half a world away – with its multinational cast of spies, scientists, diplomats and airmen – makes an exotic story.

The alliance between the two clan dictatorships in Damascus and Pyongyang is more than 35 years old. In another tunnel, this one under Mount Myohang, the North Koreans have kept as a museum piece the Kalashnikov assault rifle and pistols sent as gifts from President Hafez al-Assad of Syria to Kim Il-sung in the early years of their friendship.

Today North Korea and Syria are ruled by the sons of their 20th-century dictators – Bashar al-Assad succeeded his father in 2000 and Kim Jong-il took over in 1994. They inherited a hatred of America and a fondness for authoritarian family rule.

Syria possesses the biggest missile arsenal and the largest stockpile of chemical weapons in the Middle East, built up over the past two decades with arms bought from North Korea.

North Korea, which detonated a nuclear device in October 2006, has become pivotal to Syria’s plans to enhance and upgrade its weapons.

Syria’s liquid-fuelled Scud-C missiles depend on “essential foreign aid and assistance, primarily from North Korean entities”, said the CIA in a report to the US Congress in 2004.

Diplomats based in Pyongyang have said they now believe reports that about a dozen Syrian technicians were killed in an explosion and train crash at Ryongchon, North Korea, on April 22, 2004. North Korea blamed a technical mishap, but there were rumours of an assassination attempt on Kim, whose special train had passed through the station en route to China some hours earlier.

No independently verified cause of the disaster was made known. However, teams of military personnel wearing protective suits were seen removing debris from the section of the train in which the Syrians were travelling, according to a detailed report quoting military sources which appeared on May 7, 2004, in the Sankei Shimbun, a Japanese newspaper.

The technicians were said to be from Syria’s Centre D’Etudes et de Recherche Scientifique, a body known to be engaged in military technology.

Their bodies were flown home by a Syrian military cargo aircraft which was spotted on May 1, 2004 at Pyongyang. There was speculation among military attachés that the Syrians were transporting unconventional weapons, the paper said at the time. Diplomats said the Sankei Shimbun report was now believed to be accurate.

Last year Jane’s Defence Weekly reported that dozens of Iranian engineers and Syrians were killed on July 23 attempting to load a chemical warhead containing the nerve gases VX and sarin onto a Scud missile at a plant in Syria.

The Scuds and warheads are of North Korean design and possibly manufacture. Some analysts think North Korean scientists were helping the Syrians to attach air-burst chemical warheads to the missiles.

Syria possesses more than 100 Scud-C and ScudD missiles which it bought from North Korea in the past 15 years. In the 1990s it added cluster warheads to the Scud-Cs that experts believe are intended for chemical weapons.

Like North Korea, Syria has an extensive chemical weapons programme including sarin, VX and mustard gas, according to researchers at the Center for Nonproliferation Studies at the Monterey Institute in California.

The Scud-C is strategically worrying to Israel because Syria has deployed it with one launcher for every two missiles. The normal ratio is one to 10. The conclusion: Syria’s missiles are set up for a devastating first strike.

Since 2004 there have been a series of leaks designed to suggest that Syria has renewed its interest in atomic weapons, a claim denied by Damascus.

In December 2006 the Kuwaiti newspaper, Al-Siyasa, quoted European intelligence sources in Brussels as saying that Syria was engaged in an advanced nuclear programme in its northeastern Hasakah province.

It also quoted British security sources as identifying the man heading the programme as Major Maher Assad, brother of the president and commander of the Republican Guard.

Early last year foreign diplomats had noticed an increase in political and military visits between Syria and North Korea. They received reports of Syrian passengers on flights from Beijing to Pyongyang, almost the only air route into the country. They also spotted Middle Eastern businessmen using trains between North Korea and the industrial cities of northeast China.

Then there were clues in the official media. On August 14 Rim Kyongman, the North Korean minister of foreign trade, was in Syria to sign a protocol on “cooperation in trade and science and technology”. His delegation held the fifth meeting of a “joint economic committee” with its Syrian counterpart. No details were disclosed.

Initially, the conclusion of diplomats was that the deal involved North Korean ballistic missiles, maintenance for the existing Syrian arsenal and engineering expertise for building silos and bunkers against air attack. Now it is known that Israeli intelligence interpreted the meeting as the last piece in a nuclear jigsaw; a conclusion that Israel shared with President George W Bush.

For years the United States and Israel saw North Korean weapons sales to the Middle East as purely a source of revenue – apart from seafood, minerals and timber, North Korea is impoverished and has little else to sell. The nuclear threat in Syria was also believed to be dormant, as Damascus appeared to rely on a chemical first-strike as an unconventional deterrent.

In a period of detente, the United States and its allies concurred when China sold a 30kw nuclear reactor to Syria in 1998 under international controls.

Then, in 2003, American intelligence officials believe that Syria recruited Iraqi scientists who had fled after the fall of Saddam Hussein. Like other countries in the region, Syria renewed its pursuit of nuclear research.

The calculus changed for good after North Korea tested a nuclear bomb in 2006 and admitted to a plutonium stockpile sufficient for 10 more.

The danger to Israel is multiplied by the triangular relationship between North Korea, Syria and Iran. Syria has served as a conduit for the transport to Iran of an estimated £50m of missile components and technology sent by sea from North Korea to the Syrian port of Tartous, diplomats said.

They say Damascus and Tehran have set up a £125m joint venture to build missiles in Syria with North Korean and Chinese technical help. North Korean military engineers have worked on hardened silos and tunnels for the project near the cities of Hama and Aleppo.

Israel also noted reports from Pyongyang that Syrian and Iranian observers were present at missile test firings by the North Korean military last summer and were given valuable experimental data. Israeli sources said last week that Iran was informed “in every detail” about the nuclear reactor and had sent technicians to the site.

Such was the background against which Israel took its decision to strike. Two signals from the North Koreans in the aftermath showed that the bombs hit home.

On September 10, four days after the raid, Kim sent a personal message of congratulations to Assad on the Syrian dictator’s 42nd birthday.

“The excellent friendly and cooperative relations between the two countries are steadily growing stronger even under the complicated international situation,” Kim said.

The next day, in a message that went largely unnoticed, the North Koreans condemned the Israeli action as “illegal” and “a very dangerous provocation”.

Just days later a top Syrian official, Saeed Elias Daoud, director of the ruling Syrian Arab Ba’ath party, boarded a Russian-made vintage jet belonging to the North Korean airline, Air Koryo, for the short flight from Beijing.

Daoud brought counsel and sympathy from Assad, whose father Hafez was famed as a strategic gambler with a talent for brinkmanship.

Now Kim is waiting to see if his own gamble has paid off.

Additional reporting: Sarah Baxter in Washington

New photos I got of the oil spill clean up:

(no, the Korean army did not help with

the clean up really, but had a great "photo op"


_



Big Afghanistan update

Afghan leader criticises US over war

AFGHAN President Hamid Karzai criticized the US and British conduct of
the war in Afghanistan, telling The New York Times in an interview
published today his Government must be accorded the lead in policy
decisions.

Mr Karzai told the newspaper he wanted US forces to stop arresting
suspected Taliban members and their sympathizers, saying that fear of
arrest along with past mistreatment were discouraging them from coming
forward and laying down their arms. "It has to happen," he said of the
end to such arrests.

In calling for greater Afghan autonomy, Mr Karzai said, "For the success
of the world in Afghanistan, it would be better to recognize this
inherent character in Afghanistan and work with it and support it."

"Eventually, if the world is to succeed in Afghanistan, it will be by
building the Afghan state, not by keeping it weak," he told the Times at
his presidential office.

Mr Karzai said relations with Pakistan's new government began on a good
note. "I am fairly confident of their good intentions," he said. "If the
current government has the full backing of the military and intelligence
circles in Pakistan and with the good intentions that they have, things
will improve."

Afghan Leader Criticizes U.S., Calling Arrests and Casualties Too High

By CARLOTTA GALL

New York Times April 26, 2008

KABUL, Afghanistan President Hamid Karzai strongly criticized the
British and American conduct of the war here on Friday, insisting in an
interview that his government be given the lead in policy decisions.

Mr. Karzai said that he wanted American forces to stop arresting
suspected Taliban and their sympathizers, and that the continued threat
of arrest and past mistreatment were discouraging Taliban from coming
forward to lay down their arms.

He criticized the American-led coalition as prosecuting the war on
terrorism in Afghan villages, saying the real terrorist threat lay in
sanctuaries of the Taliban and Al Qaeda in Pakistan.

The president said that civilian casualties, which have dropped
substantially since last year, needed to cease completely. For nearly
two years the American-led coalition has refused to recognize the need
to create a trained police force, he said, leading to a critical lack of
law and order.

The comments came as Mr. Karzai is starting to point toward re-election
next year, after six years in office, and may be part of a political
calculus to appear more assertive in his dealings with foreign powers as
opponents line up to challenge him.

But they also follow a serious dip in his relations with some of the
countries contributing to the NATO-led security force and the
reconstruction of Afghanistan, and indicate that as the insurgency has
escalated, so, too, has the chafing among allies.

Complaints have been rising for months among diplomats and visiting
foreign officials about what is seen as Mr. Karzais weak leadership, in
particular his inability to curb narcotics trafficking and to remove
ineffective or corrupt officials. Some diplomats have even expressed
dismay that, for lack of an alternative, the country and its donors may
face another five years of poor management by Mr. Karzai.

He was quick to reject such criticism, pointing out the immense
difficulties that he and his government faced What is it we have not
gone through? while trying to rebuild a state that was utterly destroyed.

He called instead for greater respect of Afghanistans fierce
independence, and for more attention to be paid to building up the
country, than doing things for it.

For the success of the world in Afghanistan, it would be better to
recognize this inherent character in Afghanistan and work with it and
support it, he said, speaking at his presidential office. Eventually,
if the world is to succeed in Afghanistan, it will be by building the
Afghan state, not by keeping it weak.

Mr. Karzai said he was fighting corruption, a problem that is among the
chief complaints heard frequently by diplomats and Afghans alike. Mr.
Karzai said he had just fired an official the previous day and would be
firing more soon.

Yet the president explained that Afghanistan had never had so much money
and resources pouring in, or seen such disparities in salaries, and was
simply not capable yet of preventing the corruption.

He admitted that lots of things in the last six years could have been
handled better and singled out policies led by the United States, namely
tackling terrorism and handling the Taliban, both as prisoners and on
the battlefield.

On terrorism, he repeated a call he has made for several years, that
sanctuaries across the border in Pakistan be closed off.

There is no way but to close the sanctuaries, he said. Pakistan will
have no peace, Pakistans progress will suffer, so will Afghanistans
peace and progress, so will the worlds. If you want to live, and live
in peace, and work for prosperity, that has to happen. The sanctuaries
must go, period.

The deaths of civilians in the fighting have also been a big problem, he
said. It seriously undermines our efforts to have an effective campaign
against terrorism, he said. While NATO says civilian casualties have
declined in the last six months, Mr. Karzai said that was not good enough.

I am not happy with civilian casualties coming down; I want an end to
civilian casualties, he said. As much as one may argue its difficult,
I dont accept that argument.

He added, Because the war against terrorism is not in Afghan villages,
the war against terrorism is elsewhere, and thats where the war should
go, referring to the Taliban and Qaeda sanctuaries in Pakistan.

He said the issue had caused tension between him and American officials.
While those moments were very, very difficult, I must also be fair to
say that our partners in America have recognized my concerns and have
acted on them in good faith.

One of the biggest mistakes of the last six years has been the handling
of the Taliban, he said, and the failure of his government to guarantee
former members the amnesty that Mr. Karzai promised when the movement
was toppled in December 2001.

He blamed mistreatment by some warlords and American forces for driving
the Taliban out of the country, to Pakistan, where they regrouped and
took up weapons again.

Some of the warlords, and the coalition forces at times, in certain
areas of the country, behaved in a manner that frightened the Taliban to
move away from Afghanistan, he said. That should not have happened.

The weakness of his own government meant that he learned only much later
of some of the things that were occurring, he said.

He gave an example of a former member of the Taliban who was quietly
running a paint shop in Kabul and had been arrested three times by
American and Afghan security services.

We have to make sure that when a Talib comes to Afghanistan, that he is
safe from arrest by the coalition, he said. And we dont come to know
when the coalition arrests them; it is a major problem for us, a problem
that we have spoken about repeatedly without solution.

Asked if he could stop American forces from arresting suspected Taliban
or their sympathizers in Afghanistan, he said, We are working hard on
it, very hard on it.

He added, It has to happen.

Mr. Karzai said he had not complained to the Americans about their
treatment of people in their custody, despite long detentions, because
he did not have details of specific cases.

Despite the many problems, Mr. Karzai expressed optimism over
Afghanistans path, and said that the change of government in Pakistan
could bring progress against terrorism. We began on a very good note,
he said of relations with the new government, led by the party of former
Prime Minister Benazir Bhutto, who was killed in December.

I am fairly confident of their good intentions, he said. If the
current government has the full backing of the military and intelligence
circles in Pakistan and with the good intentions that they have, things
will improve.

The president said he supported the Pakistani governments efforts to
make peace with Taliban there who were not a threat to the rest of the
world.

But if the deal is with those that are hard-core terrorists, Al Qaeda,
and are bent upon sooner or later again causing damage to Pakistan, and
to Afghanistan and to the rest of the world, then thats wrong and we
should definitely not do it.

He said he did not know Baitullah Mehsud, the militant leader who has
been accused of instigating Ms. Bhuttos assassination, but said he
would send him some advice: All that he is doing is hurting his own
people, that he shouldnt do that.

Copyright 2008 The New York Times Company


On billionair Lakshmi Mittal

Lakshmi Mittal - Click to view image in its original context
Lakshmi Mittal

London (PTI): Indian-born steel tycoon Lakshmi Mittal is the richest man in Europe with his fortune estimated at a staggering 27.7 billion pounds, even as he emerged as Britain's wealthiest person for fourth year in a row. Over all, the steel baron, ... [47 mins ago - The Hindu]

German apology for Afghan spying/Uhrlau

BND AFFAIRS BROADENS 26.04.2008
German Spies Put Afghan Ministry under Surveillance
Germany's foreign intelligence agency was already under pressure for spying on an Afghan minister and a SPIEGEL journalist. Now SPIEGEL has learned that BND agents had an entire Afghan ministry under surveillance.
THE WORLD FROM BERLIN 25.04.2008
BND Agents 'Knew What They Were Doing'
German intelligence agents have been caught spying on a German journalist -- again. The controversy over e-mails collected from a SPIEGEL reporter has become a national scandal. Chancellor Merkel says her faith in her spy chief has been rattled, while German papers wonder if the service can be trusted at all.
GERMAN SPY CHIEF UNDER PRESSURE 24.04.2008
Agency Admits Spying on Afghan Politician and SPIEGEL Journalist
The head of Germany's foreign intelligence agency has come under fire over admissions his employees monitored e-mails exchanged between a minister in the Afghan government and a SPIEGEL journalist. Chief spy Ernst Uhrlau will likely keep his job, but the scandal is expected to shake up the organization.
BND chief Ernst Uhrlau
The BND chief was criticised for not reporting the affair

German Foreign Minister Frank-Walter Steinmeier has apologised to his Afghan counterpart for actions by Germany's foreign intelligence service, the BND.

German media reported last week that the BND had spied on the Afghan trade minister and a German journalist.

An Afghan Foreign Ministry spokesman said the apology had been accepted.



The BND could face legal action over claims it spied on Suzanne Koelbl, a reporter for Der Spiegel, and Afghan trade minister Amin Farhang in 2006.

Der Spiegel said the head of the BND, Ernst Uhrlau, had apologised to Ms Koelbl for monitoring e-mails to Mr Farhang.

But the magazine said that it was still considering legal action against the agency.

Mr Farhang says the BND has endangered his life.

The agency has not commented publicly on the case.

It is alleged to have installed Trojan spyware on Mr Farhang's computer hard disk in 2006.

A German parliamentary committee investigating the affair condemned the fact that Mr Uhrlau had not informed the government or the committee about the case. But it stopped short of calling for his resignation.




On Steinmeier

News - Europe - New face in German foreign office

Indeed, his reaction summed up the mood in Berlin as few Germans have ever heard of Mr Steinmeier. You know that Mr Schroeder has great respect for Mr Steinmeier.
21 Oct 2005

News - Europe - Profile: German foreign minister

Germany's new foreign minister Frank-Walter Steinmeier was a behind-the-scenes fixer for Chancellor Schroeder..
13 Oct 2005

On Uhrlau

Latest News Icon

News - Middle East - Mid-East success for German diplomacy

Mr Uhrlau has also said that information about the airman could surface in the next two to three months.
28 Jan 2004

News - Middle East - Israel and Hezbollah swap remains

Israel and Hezbollah exchange the remains of an Israeli for a prisoner and the bodies of two guerrillas..
Last Updated: Monday, 15 October 2007, 18:09 GMT 19:09 UK
15 Oct 2007

More results from "News - Middle East"

News - Europe - Call for anti-extremist action

NPD growth The man in overall charge of Germany's intelligence services, Ernst Uhrlau, said he was optimistic about the chances of obtaining a ban on the party at the Constitutional Court.
13 Aug 2000

News - South Asia - Germany rejects US troops appeal

And Ernst Uhrlau, the head of Germany's foreign intelligence service (BND), has warned that the security situation in Afghanistan is expected to worsen in the coming months.
1 Feb 2008

German Spy Chief Warns Of Al-Qaeda's Growing Strength In North Africa

2008-03-26 03:19:49
Intellpuke: Spiegel, Germany's news magazine, recently interviewed Ernst Uhrlau, the president of Germany's foreign intelligence agency, the BND, about the risk of attack by Islamist terrorists in Germany, how German Muslims are training in camps in Afghanistan and the risk from al-Qaeda in North Africa. The interview follows:


The fight against Islamist terrorism is becoming increasingly globalized as intelligence agencies around the world cooperate and share information. One of the major nodes in that network is Germany's foreign intelligence agency, the Bundesnachrichtendienst (BND), which is based in Pullach in Bavaria.

Together wit